JAM-A Antibody (2E3-1C8)

Images

 
Western Blot: JAM-A Antibody (2E3-1C8) [H00050848-M01] - F11R monoclonal antibody (M01), clone 2E3-1C8 Analysis of F11R expression in HepG2.
Immunohistochemistry-Paraffin: JAM-A Antibody (2E3-1C8) [H00050848-M01] - Analysis of monoclonal antibody to F11R on formalin-fixed paraffin-embedded human breast cancer tissue. Antibody concentration 1 ug/ml.
Western Blot: JAM-A Antibody (2E3-1C8) [H00050848-M01] - Analysis of F11R expression in transfected 293T cell line by F11R monoclonal antibody (M01), clone 2E3-1C8. Lane 1: F11R transfected lysate (Predicted MW: 32.6 ...read more
ELISA: JAM-A Antibody (2E3-1C8) [H00050848-M01] - Detection limit for recombinant GST tagged F11R is approximately 0.3ng/ml as a capture antibody.
Proximity Ligation Assay: JAM-A Antibody (2E3-1C8) [H00050848-M01] - Analysis of protein-protein interactions between PRKCZ and F11R. HeLa cells were stained with anti-PRKCZ rabbit purified polyclonal 1:1200 and ...read more
Sandwich ELISA: JAM-A Antibody (2E3-1C8) [H00050848-M01] - Detection limit for recombinant GST tagged F11R is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, PLA
Clone
2E3-1C8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

JAM-A Antibody (2E3-1C8) Summary

Immunogen
F11R (AAH01533, 1 a.a. ~ 300 a.a) full length recombinant protein with GST tag.MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPE NNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYE DRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKL IVLVPPSKPTVNIPSSATIGNRAVLTCSEQDGSPPSEYTWFK DGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASDTGEY SCEARNGYGTPMTSNAVRMEAVERNVGVIVAAVLV
Localization
Type I membrane protein
Specificity
F11R - F11 receptor
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
F11R
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Proximity Ligation Assay
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Publications
Read Publications using
H00050848-M01 in the following applications:

  • IHC
    1 publication
  • 2 publications
  • WB
    1 publication

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for JAM-A Antibody (2E3-1C8)

  • CD321 antigen
  • CD321
  • F11 receptor
  • F11R
  • JAM-1
  • JAM1CD321
  • JAMA
  • JAM-A
  • JCAMJAM
  • Junctional adhesion molecule 1Platelet F11 receptor
  • junctional adhesion molecule A
  • PAM-1
  • PAM-1KAT
  • Platelet adhesion molecule 1

Background

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is an important regulator of tight junction assembly in epithelia. In addition, the encoded protein can act as (1) a receptor for reovirus, (2) a ligand for the integrin LFA1, involved in leukocyte transmigration, and (3) a platelet receptor. Multiple 5' alternatively spliced variants, encoding the same protein, have been identified but their biological validity has not been established.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00050848-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PLA
NBP1-85047
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
AF3449
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF1213
Species: Mu
Applications: WB, IHC, Block, ICC
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-89627
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1074
Species: Hu, Mu
Applications: WB, Simple Western, IHC, Neut
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF7817
Species: Hu, Mu, Rt
Applications: WB
AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-97841
Species: Hu
Applications: IP (-), WB
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
H00050848-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PLA

Publications for JAM-A Antibody (H00050848-M01)(9)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: IHC, IHC-P, WB.


Filter By Application
IHC
(1)
IHC-P
(2)
WB
(1)
All Applications
Filter By Species
Human
(3)
All Species
Showing Publications 1 - 9 of 9.
Publications using H00050848-M01 Applications Species
Neutzner A, Power L, Durrenberger M et al. A perfusion bioreactor-based 3D model of the subarachnoid space based on a meningeal tissue construct Fluids Barriers CNS Jun 13 2019 [PMID: 31189484] (IHC, Human) IHC Human
Baek K and Choi Y. Estrogen reinforces barrier formation and protects against tumor necrosis factor alpha-induced barrier dysfunction in oral epithelial cells. J Periodontal Implant Sci. 2018 Oct 24 [PMID: 30405936]
Vellanki SH, Cruz RGB, Jahns H et al. Natural compound Tetrocarcin-A downregulates Junctional Adhesion Molecule-A in conjunction with HER2 and Inhibitor of Apoptosis Proteins and inhibits tumor cell growth. Cancer Lett Oct 9 2018 [PMID: 30312728]
Zeleny TNC, Kohler C, Neutzner A et al. Cell-Cell Interaction Proteins (Gap Junctions, Tight Junctions, and Desmosomes) and Water Transporter Aquaporin 4 in Meningothelial Cells of the Human Optic Nerve Front Neurol 2017 Jul 14 [PMID: 28706505] (IHC-P, Human) IHC-P Human
Huang JY, Xu YY, Sun Z et al. Low JAM-A expression correlates with poor prognosis in gastric cancer. Journal of Surgical Research. 2014 [PMID: 25033702]
Fong D, Spizzo G, Mitterer M et al. Low Expression of Junctional Adhesion Molecule A Is Associated with Metastasis and Poor Survival in Pancreatic Cancer. Ann Surg Oncol. 2012 May 02 [PMID: 22549289]
McSherry EA, McGee SF, Jirstrom K et al. JAM-A expression positively correlates with poor prognosis in breast cancer patients. Int J Cancer. 2009 Sep 15 [PMID: 19533747]
Huang JY, Xu YY, Sun Z et al. Low JAM-A expression correlates with poor prognosis in gastric cancer. J Surg Res 2014 Jun 13 (IHC-P, WB, Human) IHC-P, WB Human
Gutwein P, Schramme A, Voss B et al. Downregulation of junctional adhesion molecule-A is involved in the progression of clear cell renal cell carcinoma. Biochem Biophys Res Commun 380(2):387-91. 2009 Mar 6. [PMID: 19250634]

Reviews for JAM-A Antibody (H00050848-M01) (0)

There are no reviews for JAM-A Antibody (H00050848-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for JAM-A Antibody (H00050848-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional JAM-A Products

Bioinformatics Tool for JAM-A Antibody (H00050848-M01)

Discover related pathways, diseases and genes to JAM-A Antibody (H00050848-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for JAM-A Antibody (H00050848-M01)

Discover more about diseases related to JAM-A Antibody (H00050848-M01).
 

Pathways for JAM-A Antibody (H00050848-M01)

View related products by pathway.

PTMs for JAM-A Antibody (H00050848-M01)

Learn more about PTMs related to JAM-A Antibody (H00050848-M01).

Blogs on JAM-A

There are no specific blogs for JAM-A, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our JAM-A Antibody (2E3-1C8) and receive a gift card or discount.

Bioinformatics

Gene Symbol F11R
Entrez
OMIM
Uniprot