Occludin Antibody

Images

 
Western Blot: Occludin Antibody [NBP1-87402] - Analysis in human cell line CACO-2 and human cell line HeLa.
Immunocytochemistry/ Immunofluorescence: Occludin Antibody [NBP1-87402] - Staining of human cell line A-431 shows localization to plasma membrane & cell junctions. Antibody staining shown in green.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human prostate shows negative membranous positivity in glandular cells as expected.
Genetic Strategies: Western Blot: Occludin Antibody [NBP1-87402] - Lane 1: untreated vascular endothelial cells Lane 2: vascular endothelial cells + control siRNA. Primary antibody was diluted 1:1000. Image ...read more
Immunocytochemistry/ Immunofluorescence: Occludin Antibody [NBP1-87402] - Methanol fixed, mouse choroid plexus cells were stained with Occludin antibody. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human breast cancer shows moderate membranous positivity in tumor cells.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human prostate cancer shows moderate membranous positivity in tumor cells.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human stomach shows moderate membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

Occludin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEED
Marker
Tight Junctions Marker
Specificity
Specificity of human Occludin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OCLN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Knockdown Validated
Application Notes
ICC/IF reported in scientific literature (PMID: 28848383), and a verified customer review. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Occludin antibody validated for WB from a verified customer review.
Control Peptide
Occludin Protein (NBP1-87402PEP)
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-87402 in the following applications:

Publications
Read Publications using
NBP1-87402 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 31715313). Mouse reactivity reported in (PMID: 30685438), and a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Occludin Antibody

  • BLCPMG
  • Occludin
  • OCLN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85047
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
H00009076-M01
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-66784
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-41187
Species: Hu
Applications: WB, ELISA, IF
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-49230
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-79843
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, CyTOF-ready
NBP1-86850
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Occludin Antibody (NBP1-87402)(11)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 4 applications: ICC/IF, IHC, IHC-P, WB.


Filter By Application
ICC/IF
(3)
IHC
(5)
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
Mouse
(5)
Rat
(1)
All Species
Showing Publications 1 - 10 of 11. Show All 11 Publications.
Publications using NBP1-87402 Applications Species
Heldt NA, Seliga A, Winfield M et al. Electronic cigarette exposure disrupts blood-brain barrier integrity and promotes neuroinflammation Brain Behav. Immun. Mar 31 2020 [PMID: 32243899] (IHC, Mouse) IHC Mouse
Shinde T, Perera AP, Vemuri R et al. Synbiotic supplementation with prebiotic green banana resistant starch and probiotic Bacillus coagulans spores ameliorates gut inflammation in mouse model of inflammatory bowel diseases Eur J Nutr Feb 17 2020 [PMID: 32067099] (IHC, Mouse) IHC Mouse
Shastri S, Shinde T, Sohal SS et al. Idebenone Protects against Acute Murine Colitis via Antioxidant and Anti-Inflammatory Mechanisms Int J Mol Sci Jan 12 2020 [PMID: 31940911] (IHC, Mouse) IHC Mouse
Evran S, Calis F, Akkaya E et al. The effect of high mobility group box-1 protein on cerebral edema, blood-brain barrier, oxidative stress and apoptosis in an experimental traumatic brain injury model Brain Res. Bull. Nov 9 2019 [PMID: 31715313] (IHC, Rat) IHC Rat
Messal N, Fernandez N, Dayot S et al. Ectopic expression of OX1R in ulcerative colitis mediates anti-inflammatory effect of orexin-A Biochimica et Biophysica Acta (BBA) - Molecular Basis of Disease Nov 1 2018 [PMID: 30251681] (WB, Mouse) WB Mouse
Mikula-Pietrasik J, Uruski P, Szubert S et al. Malignant ascites determine the transmesothelial invasion of ovarian cancer cells Int. J. Biochem. Cell Biol. 2017 Sep 06 [PMID: 28888784] (IHC-P, Human) IHC-P Human
Liu W, Schrott-Fischer A, Glueckert R et al. The Human Cochlear Battery - Claudin-11 Barrier and Ion Transport Proteins in the Lateral Wall of the Cochlea Front Mol Neurosci 2017 Aug 29 [PMID: 28848383] (ICC/IF, Human) ICC/IF Human
Baumann V Identification and manipulation of chromatin barriers in transcriptional reprogramming Thesis (ICC/IF) ICC/IF
Almassy J, Diszhazi G, Skaliczki M et al. Expression of BK channels and Na+-K+ pumps in the apical membrane of lacrimal acinar cells suggests a new molecular mechanism for primary tear-secretion. Ocul Surf Jan 24 2019 [PMID: 30685438] (ICC/IF, Mouse) ICC/IF Mouse
Rom S, Zuluaga-Ramirez V, Gajghate S et al. Hyperglycemia-Driven Neuroinflammation Compromises BBB Leading to Memory Loss in Both Diabetes Mellitus (DM) Type 1 and Type 2 Mouse Models. Mol. Neurobiol. Jul 5 2018 [PMID: 29974394] (IHC) IHC
Show All 11 Publications.

Reviews for Occludin Antibody (NBP1-87402) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Mouse.

Reviews using NBP1-87402:
Filter by Applications
WB
(1)
IF
(1)
All Applications
Filter by Species
Mouse
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot Occludin NBP1-87402
Enlarge
5
reviewed by:
James Xiao
WB Mouse 06/15/2017
View

Summary

ApplicationWestern Blot
Sample TestedPrimary lung endothelial cells
SpeciesMouse
LotB106982

Comments

CommentsMembrane was blocked in 5% milk in TBST. Primary antibody dilution was 1:1000 and the dilution for the secondary ab was 1:5000.
Immunofluorescence Occludin NBP1-87402
Enlarge
4
reviewed by:
Anonymous
IF Mouse 04/06/2015
View

Summary

ApplicationImmunofluorescence
Sample TestedMouse choroid plexus cells
SpeciesMouse

Blocking

Blocking DetailsScytek super block blocking reagent-1h-100%

Primary Anitbody

Dilution Ratio1:50 at room temperature for 1h

Secondary Antibody

Secondary DescriptionAlexafluor 488 anti-rabbit, 1h at room temperature
Secondary Concentration1:250

Details

Detection NotesImaged on Zeiss microscope. DAPI was used to image nuclei. EMbedding medium: Gelvatol
Fixation DetailsMethanol fixation, NP-40 permeabilization
Wash DescriptionPBS washes, 3 times.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Occludin Antibody (NBP1-87402) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Occludin Products

Bioinformatics Tool for Occludin Antibody (NBP1-87402)

Discover related pathways, diseases and genes to Occludin Antibody (NBP1-87402). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Occludin Antibody (NBP1-87402)

Discover more about diseases related to Occludin Antibody (NBP1-87402).
 

Pathways for Occludin Antibody (NBP1-87402)

View related products by pathway.

PTMs for Occludin Antibody (NBP1-87402)

Learn more about PTMs related to Occludin Antibody (NBP1-87402).

Blogs on Occludin

There are no specific blogs for Occludin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0

James Xiao
06/15/2017
Application: WB
Species: Mouse

Anonymous
04/06/2015
Application: IF
Species: Mouse

Bioinformatics

Gene Symbol OCLN