Occludin Antibody - BSA Free

Western Blot: Occludin Antibody [NBP1-87402] - Analysis in human cell line CACO-2 and human cell line HeLa.

Western Blot: Occludin Antibody [NBP1-87402] - Lane 1: untreated vascular endothelial cells Lane 2: vascular endothelial cells + control siRNA. Primary antibody was diluted 1:1000. WB image submitted by a verified customer review.

Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human prostate shows negative membranous positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human breast cancer shows moderate membranous positivity in tumor cells.

Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human prostate cancer shows moderate membranous positivity in tumor cells.

Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human stomach shows moderate membranous positivity in glandular cells.

ELISA: Occludin Antibody [NBP1-87402] - Occludin levels in untreated and LPS treated rat intestinal tissues. ELISA image submitted by a verified customer review.

KD improved vascular hyperpermeability and reduced vascular stiffness and leakage in type 2 diabetic mice. (A, B) The Evans blue injection and haematoxylin and eosin staining of abdominal aorta were performed for different groups, original magnification, ×10 (haematoxylin and eosin staining). Scale bar, 50 μm (haematoxylin and eosin staining). (C–H) The protein levels of vascular PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin were detected by Immunoblotting. Data are represented as mean +/- SEM, each assay was performed independently three times (n = 12 per group). KD (ketogenic diet), SD (standard diet). **p < 0.01 C57BL/6J‐KD versus C57BL/6J‐SD, ***p < 0.001 C57BL/6J‐KD versus C57BL/6J‐SD, #p < 0.05 db/db‐KD versus db/db‐SD, ##p < 0.01 db/db‐KD versus db/db‐SD, ###p < 0.001 db/db‐KD versus db/db‐SD, +p < 0.05 C57BL/J‐SD versus db/db‐SD, ++p < 0.01 C57BL/J‐SD versus db/db‐SD, +++p < 0.001 C57BL/J‐SD versus db/db‐SD, &&p < 0.01 C57BL/6J‐KD versus db/db‐KD, &&&p < 0.001 C57BL/6J‐KD versus db/db‐KD (anova, Student–Newman–Keuls q‐test). Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Pes1 knockout in mice decreased vascular permeability. (A, B) The Evans blue injection and haematoxylin and eosin staining of abdominal aorta were conducted in different groups, original magnification, ×10 (haematoxylin and eosin staining). Scale bar, 50 μm (haematoxylin and eosin staining). (C–F) The protein levels of vascular PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin were measured by Immunoblotting. Data were represented as mean +/- SEM, each assay was performed independently three times. **p < 0.01, ***p < 0.001 compared with control (Student's t‐test). Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

beta ‐HB treatment impaired the increment of paracellular permeability by in vitro supplementation of Pes1. (A, B) The protein levels of PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin in MVECs were detected by immunoblotting after Flag‐Pes1 plus beta ‐HB treatment. (C, D) Shown are immunofluorescence images of Flag‐Pes1 plus beta ‐HB‐treated MVECs for Occludin and VE‐cadherin expression and localizations, scale bar represents 20 μm. The nuclei were stained with DAPI. (E) Exhibited is the paracellular permeability in the cultured MVECs in different groups. Data were represented as mean +/- SEM, each experiment was performed independently three times. **p < 0.01, ***p < 0.001 compared with control (anova, Student–Newman–Keuls q‐test). Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

beta ‐HB treatment reduced vascular endothelial paracellular permeability in vitro. (A, B) The protein levels of PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin in MVECs were detected by immunoblotting after 2 mM beta ‐HB treatment for 24 h. (C–H) Displayed are immunofluorescence images of beta ‐HB‐treated MVECs for VE‐cadherin, VEGF and PES1 expression and localizations, scale bar represents 20 μm. The nuclei were stained with DAPI. (I) Exhibited is the paracellular permeability in the cultured MVECs under different treatments. Ctrl (Control), beta ‐HB ( beta ‐hydroxybutyric acid). Data were represented as mean +/- SEM, each experiment was performed independently three times. **p < 0.01, ***p < 0.001 compared with control (Student's t‐test). Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

PLX3397 reduces tight junction expressionA, BWestern blot of lysates from PLX3397 treated b.End3 cells for tight junction proteins ZO‐1, Occludin and Claudin‐5 (A). The horizontal line indicates untreated cells, with increasing PLX3397 concentrations (5, 10, 20 μM). Corresponding densitometry is given in (B). (One‐way ANOVA with Dunnett’s post‐test for multiple comparisons, *P < 0.05, **P < 0.005, ***P < 0.0005, n = 3 independent experiments, error bars indicate SEM)CGene expression changes at 24 (top) and 48 (bottom) h in PLX3397 treated b.End3 cells shown by qPCR for Tjp1, Ocln and Cldn5 (*P < 0.05, **P < 0.006, n = 3 independent experiments one‐way ANOVA with Dunnett’s post‐test, error bars indicate SEM).DqPCR analysis of tight junction and CSF‐1R pathway gene expression changes at 24 h in PLX3397 treated MBECs (one‐way ANOVA with Dunnett’s post‐test for multiple comparisons, **P < 0.009, n = 3 independent experiments, error bars indicate SEM).EFITC‐4kDA transwell permeability assay of primary mouse microvascular endothelial cells (MBECs) treated for 24 h with PLX3397 at indicated doses (one‐way ANOVA with Dunnett’s correction, n = 3 technical replicates for flux assay, one‐way ANOVA with Dunnett’s post‐test for multiple comparisons, **P = 0.0012, error bars indicate SEM). Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/33350588), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

In vitro knockdown of Pes1 lowered the paracellular permeability of MVECs. (A, B) The protein levels of PES1, VEGF, VE‐cadherin, Ang‐1 and Occludin in MVECs were detected by immunoblotting after Pes1‐siRNA treatment. (C, D) Shown are immunofluorescence images of Pes1‐siRNA‐treated MVECs for Occludin and VE‐cadherin expression and localizations, scale bar represents 20 μm. The nuclei were stained with DAPI. (E) Exhibited is the paracellular permeability in the cultured MVECs in different groups. Data were represented as mean +/- SEM, each experiment was performed independently three times. **p < 0.01, ***p < 0.001 compared with control (Student's t‐test). Image collected and cropped by CiteAb from the following open publication (//pubmed.ncbi.nlm.nih.gov/37060584), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Occludin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEED
• Marker: Tight Junctions Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OCLN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Validated from a verified customer review
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/mL
• Application Notes: Reviews and literature that use this antibody in ICC/IF are from a previous lot. This antibody is not suitable for ICC/IF usage. IHC-Paraffin, HIER pH 6 retrieval is recommended
• Control Peptide:

  Occludin Protein (NBP1-87402PEP)

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 31715313). Mouse reactivity reported in (PMID: 30685438), and a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Occludin Antibody - BSA Free

• BLCPMG
• Occludin
• OCLN

Background

The Occludin gene encodes an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Occludin Antibody (NBP1-87402)(25)

Publications using NBP1-87402

• Wang S, Zhou J, Lu J et al. A ketogenic diet improves vascular hyperpermeability in type 2 diabetic mice by downregulating vascular pescadillo1 expression Journal of cellular and molecular medicine 2023-04-15 [PMID: 37060584] (WB, Mouse)
  
  Details:
  1:500 WB dilution
• Hamade DF, Epperly MW, Fisher R et al. Release of Interferon-? (IFN-?) from Probiotic Limosilactobacillus reuteri-IFN-? (LR-IFN-?) Mitigates Gastrointestinal Acute Radiation Syndrome (GI-ARS) following Whole Abdominal Irradiation Cancers 2023-03-08 [PMID: 36980556] (IHC, Mouse)
• Pretorius L, Smith C. Aspalathus linearis (Rooibos) and Agmatine May Act Synergistically to Beneficially Modulate Intestinal Tight Junction Integrity and Inflammatory Profile Pharmaceuticals (Basel) 2022-09-01 [PMID: 36145318] (Immunocytochemistry/ Immunofluorescence, Human)
• Baumann V Identification and manipulation of chromatin barriers in transcriptional reprogramming Thesis (ICC/IF)
• Greene C, Rebergue N, Fewell G et Al. NX210c drug candidate peptide strengthens mouse and human blood-brain barriers Fluids Barriers CNS 2024-09-27 [PMID: 39334382]
• Lesha Pretorius, Carine Smith Green rooibos (Aspalathus linearis) promotes gut health: insight into mechanisms. Journal of ethnopharmacology 2023-11-21 [PMID: 37923252]
• Werawatganon, D;Vivatvakin, S;Somanawat, K;Tumwasorn, S;Klaikeaw, N;Siriviriyakul, P;Chayanupatkul, M; Effects of probiotics on pancreatic inflammation and intestinal integrity in mice with acute pancreatitis BMC complementary medicine and therapies 2023-05-22 [PMID: 37217916] (IHC-P, Mouse)
• Kansakar U, Gambardella J, Varzideh F et al. miR-142 Targets TIM-1 in Human Endothelial Cells: Potential Implications for Stroke, COVID-19, Zika, Ebola, Dengue, and Other Viral Infections International Journal of Molecular Sciences 2022-09-06 [PMID: 36142146] (Immunocytochemistry/ Immunofluorescence, Human)
• Li Y, Wei JY, Liu H et al. An oxygen-adaptive interaction between SNHG12 and occludin maintains blood-brain barrier integrity Cell reports 2022-04-12 [PMID: 35417709] (ICC/IF, Human)
• Pretorius L, Van Staden ADP, Van der Merwe JJ et al. Alterations to microbial secretome by estrogen may contribute to sex bias in irritable bowel syndrome Inflammopharmacology 2022-01-13 [PMID: 35022916]
• Hua Q, Han Y, Zhao H et al. Punicalagin alleviates renal injury via the gut-kidney axis in high-fat diet-induced diabetic mice Food & function 2022-01-06 [PMID: 34989745] (IHC-P)
• Marika Haderer, Philip Neubert, Eva Rinner, Annika Scholtis, Lucile Broncy, Heidi Gschwendtner, Arne Kandulski, Vlad Pavel, Alexander Mehrl, Christoph Brochhausen, Sophie Schlosser, Karsten Gülow, Claudia Kunst, Martina Müller Novel pathomechanism for spontaneous bacterial peritonitis: disruption of cell junctions by cellular and bacterial proteases Gut 2022-03-01 [PMID: 33707230]
• Delaney C, Farrell M, Doherty CP et al. Attenuated CSF-1R signalling drives cerebrovascular pathology EMBO molecular medicine 2020-12-22 [PMID: 33350588] (WB, Mouse, Human)
• Patterson L, Allen J, Posey I et al. Glucosylceramide production maintains colon integrity in response to Bacteroides fragilis toxin-induced colon epithelial cell signaling FASEB J 2020-10-13 [PMID: 33047400] (Immunocytochemistry/ Immunofluorescence, Human)
• Heldt NA, Seliga A, Winfield M et al. Electronic cigarette exposure disrupts blood-brain barrier integrity and promotes neuroinflammation Brain Behav. Immun. 2020-03-31 [PMID: 32243899] (IF/IHC, Mouse)
• Shi Y, Li R, Yang J et al. No tight junctions in tight junction protein-1 expressing HeLa and fibroblast cells Int J Physiol Pathophysiol Pharmacol 2020-05-19 [PMID: 32067099] (IF/IHC, Mouse)
• Shastri S, Shinde T, Sohal SS et al. Idebenone Protects against Acute Murine Colitis via Antioxidant and Anti-Inflammatory Mechanisms Int J Mol Sci 2020-01-12 [PMID: 31940911] (IF/IHC, Mouse)
• Almassy J, Diszhazi G, Skaliczki M et al. Expression of BK channels and Na+-K+ pumps in the apical membrane of lacrimal acinar cells suggests a new molecular mechanism for primary tear-secretion. Ocul Surf 2019-01-24 [PMID: 30685438] (ICC/IF, Mouse)
• Messal N, Fernandez N, Dayot S et al. Ectopic expression of OX1R in ulcerative colitis mediates anti-inflammatory effect of orexin-A Biochimica et Biophysica Acta (BBA) - Molecular Basis of Disease 2018-11-01 [PMID: 30251681] (WB, Mouse)
• Rom S, Zuluaga-Ramirez V, Gajghate S et al. Hyperglycemia-Driven Neuroinflammation Compromises BBB Leading to Memory Loss in Both Diabetes Mellitus (DM) Type 1 and Type 2 Mouse Models. Mol. Neurobiol. 2018-07-05 [PMID: 29974394] (IF/IHC)
• Mikula-Pietrasik J, Uruski P, Szubert S et al. Malignant ascites determine the transmesothelial invasion of ovarian cancer cells Int. J. Biochem. Cell Biol. 2017-09-06 [PMID: 28888784] (IHC-P, Human)
• Brychka D, Ayala-Nunez N, Bare Y et al. Targeting monocytic Occludin impairs monocyte transmigration and HIV neuroinvasion bioRxiv 2023-09-12 (ICC/IF, Human)
• Evran S, Calis F, Akkaya E et al. The effect of high mobility group box-1 protein on cerebral edema, blood-brain barrier, oxidative stress and apoptosis in an experimental traumatic brain injury model Brain Res. Bull. 2019-11-09 [PMID: 31715313] (IF/IHC, Rat)
• Li H, Sun J, Du J et al. Clostridium butyricum exerts a neuroprotective effect in a mouse model of traumatic brain injury via the gut-brain axis. Neurogastroenterol Motil 2018-05-01 [PMID: 29193450]

Reviews for Occludin Antibody (NBP1-87402) (4)

Average Rating: 4

(Based on 4 reviews)

We have 4 reviews tested in 2 species: Mouse, Rat.

reviewed by: Russ Tas ICC Rat 04/06/2022

Summary

• Application: Immunocytochemistry
• Sample Tested: IEC-6 rat intestinal epithelial cells
• Species: Rat
• Lot: 10666

reviewed by: Verified Customer ELISA Rat 06/01/2021

Summary

• Application: ELISA
• Sample Tested: rat intestine
• Species: Rat
• Lot: 000010666

reviewed by: James Xiao WB Mouse 06/15/2017

Summary

• Application: Western Blot
• Sample Tested: Primary lung endothelial cells
• Species: Mouse
• Lot: B106982

Comments

• Comments: Membrane was blocked in 5% milk in TBST. Primary antibody dilution was 1:1000 and the dilution for the secondary ab was 1:5000.

reviewed by: Verified Customer IF Mouse 04/06/2015

Summary

• Application: Immunofluorescence
• Sample Tested: Mouse choroid plexus cells
• Species: Mouse

Bioinformatics

• Gene Symbol: OCLN