Occludin Antibody

Images

 
Orthogonal Strategies: Western Blot: Occludin Antibody [NBP1-87402] - Analysis in human cell line CACO-2 and human cell line HeLa.
Genetic Strategies: Western Blot: Occludin Antibody [NBP1-87402] - Lane 1: untreated vascular endothelial cells Lane 2: vascular endothelial cells + control siRNA. Primary antibody was diluted 1:1000. WB image ...read more
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human prostate shows negative membranous positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human breast cancer shows moderate membranous positivity in tumor cells.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human prostate cancer shows moderate membranous positivity in tumor cells.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human stomach shows moderate membranous positivity in glandular cells.
ELISA: Occludin Antibody [NBP1-87402] - Occludin levels in untreated and LPS treated rat intestinal tissues. ELISA image submitted by a verified customer review.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Occludin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEED
Marker
Tight Junctions Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OCLN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/mL
Application Notes
Reviews and literature that use this antibody in ICC/IF are from a previous lot. This antibody is not suitable for ICC/IF usage. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Occludin antibody validated for WB and ELISA from a verified customer reviews.
Control Peptide
Occludin Protein (NBP1-87402PEP)
Reviewed Applications
Read 4 Reviews rated 4
using
NBP1-87402 in the following applications:

Publications
Read Publications using
NBP1-87402 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 31715313). Mouse reactivity reported in (PMID: 30685438), and a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Occludin Antibody

  • BLCPMG
  • Occludin
  • OCLN

Background

The Occludin gene encodes an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
H00009076-M01
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-02259
Species: Hu, Mu, Po, Rt
Applications: Flow-IC, Flow, ICC/IF
MAB4219
Species: Hu
Applications: CyTOF-ready, Flow
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP3-18555
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-49230
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DMP900
Species: Hu
Applications: ELISA
NB100-74633
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-86850
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-87402
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, KD

Publications for Occludin Antibody (NBP1-87402)(20)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 5 applications: ICC/IF, IF/IHC, IHC, IHC-P, WB.


Filter By Application
ICC/IF
(3)
IF/IHC
(5)
IHC
(1)
IHC-P
(3)
WB
(4)
All Applications
Filter By Species
Human
(3)
Mouse
(9)
Rat
(1)
All Species
Showing Publications 1 - 10 of 20. Show All 20 Publications.
Publications using NBP1-87402 Applications Species
Werawatganon, D;Vivatvakin, S;Somanawat, K;Tumwasorn, S;Klaikeaw, N;Siriviriyakul, P;Chayanupatkul, M; Effects of probiotics on pancreatic inflammation and intestinal integrity in mice with acute pancreatitis BMC complementary medicine and therapies 2023-05-22 [PMID: 37217916] (IHC-P, Mouse) IHC-P Mouse
Wang S, Zhou J, Lu J et al. A ketogenic diet improves vascular hyperpermeability in type 2 diabetic mice by downregulating vascular pescadillo1 expression Journal of cellular and molecular medicine 2023-04-15 [PMID: 37060584] (WB, Mouse)

Details:
1:500 WB dilution
WB Mouse
Hamade DF, Epperly MW, Fisher R et al. Release of Interferon-? (IFN-?) from Probiotic Limosilactobacillus reuteri-IFN-? (LR-IFN-?) Mitigates Gastrointestinal Acute Radiation Syndrome (GI-ARS) following Whole Abdominal Irradiation Cancers 2023-03-08 [PMID: 36980556] (IHC, Mouse) IHC Mouse
Pretorius L, Smith C. Aspalathus linearis (Rooibos) and Agmatine May Act Synergistically to Beneficially Modulate Intestinal Tight Junction Integrity and Inflammatory Profile Pharmaceuticals (Basel) 2022-09-01 [PMID: 36145318]
Kansakar U, Gambardella J, Varzideh F et al. miR-142 Targets TIM-1 in Human Endothelial Cells: Potential Implications for Stroke, COVID-19, Zika, Ebola, Dengue, and Other Viral Infections International Journal of Molecular Sciences 2022-09-06 [PMID: 36142146] (WB) WB
Baumann V Identification and manipulation of chromatin barriers in transcriptional reprogramming Thesis (ICC/IF) ICC/IF
Li Y, Wei JY, Liu H et al. An oxygen-adaptive interaction between SNHG12 and occludin maintains blood-brain barrier integrity Cell reports 2022-04-12 [PMID: 35417709] (ICC/IF, Human) ICC/IF Human
Pretorius L, Van Staden ADP, Van der Merwe JJ et al. Alterations to microbial secretome by estrogen may contribute to sex bias in irritable bowel syndrome Inflammopharmacology 2022-01-13 [PMID: 35022916]
Hua Q, Han Y, Zhao H et al. Punicalagin alleviates renal injury via the gut-kidney axis in high-fat diet-induced diabetic mice Food & function 2022-01-06 [PMID: 34989745] (IHC-P) IHC-P
Delaney C, Farrell M, Doherty CP et al. Attenuated CSF-1R signalling drives cerebrovascular pathology EMBO molecular medicine 2020-12-22 [PMID: 33350588] (WB, Mouse, Human) WB Mouse, Human
Show All 20 Publications.

Reviews for Occludin Antibody (NBP1-87402) (4) 44

Average Rating: 4
(Based on 4 reviews)
We have 4 reviews tested in 2 species: Mouse, Rat.

Reviews using NBP1-87402:
Filter by Applications
ICC
(1)
ELISA
(1)
WB
(1)
IF
(1)
All Applications
Filter by Species
Mouse
(2)
Rat
(2)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry Occludin NBP1-87402
Enlarge
3
reviewed by:
Russ Tas
ICC Rat 04/06/2022
View

Summary

ApplicationImmunocytochemistry
Sample TestedIEC-6 rat intestinal epithelial cells
SpeciesRat
Lot10666
ELISA Occludin NBP1-87402
Enlarge
4
reviewed by:
Verified Customer
ELISA Rat 06/01/2021
View

Summary

ApplicationELISA
Sample Testedrat intestine
SpeciesRat
Lot000010666
Western Blot Occludin NBP1-87402
Enlarge
5
reviewed by:
James Xiao
WB Mouse 06/15/2017
View

Summary

ApplicationWestern Blot
Sample TestedPrimary lung endothelial cells
SpeciesMouse
LotB106982

Comments

CommentsMembrane was blocked in 5% milk in TBST. Primary antibody dilution was 1:1000 and the dilution for the secondary ab was 1:5000.
Immunofluorescence Occludin NBP1-87402
Enlarge
4
reviewed by:
Verified Customer
IF Mouse 04/06/2015
View

Summary

ApplicationImmunofluorescence
Sample TestedMouse choroid plexus cells
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Occludin Antibody (NBP1-87402) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Occludin Products

Bioinformatics Tool for Occludin Antibody (NBP1-87402)

Discover related pathways, diseases and genes to Occludin Antibody (NBP1-87402). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Occludin Antibody (NBP1-87402)

Discover more about diseases related to Occludin Antibody (NBP1-87402).
 

Pathways for Occludin Antibody (NBP1-87402)

View related products by pathway.

PTMs for Occludin Antibody (NBP1-87402)

Learn more about PTMs related to Occludin Antibody (NBP1-87402).
 

Research Areas for Occludin Antibody (NBP1-87402)

Find related products by research area.

Blogs on Occludin

There are no specific blogs for Occludin, but you can read our latest blog posts.
mFlour Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
1
4
2
3
1
2
0
1
0

Russ Tas
04/06/2022
Application: ICC
Species: Rat

Verified Customer
06/01/2021
Application: ELISA
Species: Rat

James Xiao
06/15/2017
Application: WB
Species: Mouse

Bioinformatics

Gene Symbol OCLN