Home » Occludin » Occludin Research Products » Occludin Antibody

Occludin Antibody

 (11 Publications)
 (2 Reviews)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Occludin Antibody [NBP1-87402] - Analysis in human cell line CACO-2 and human cell line HeLa.
Western Blot: Occludin Antibody [NBP1-87402] - Analysis in human cell line CACO-2 and human cell line HeLa.
Immunocytochemistry/ Immunofluorescence: Occludin Antibody [NBP1-87402] - Staining of human cell line A-431 shows localization to plasma membrane & cell junctions. Antibody staining shown in green.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human prostate shows negative membranous positivity in glandular cells as expected.
Genetic Strategies: Western Blot: Occludin Antibody [NBP1-87402] - Lane 1: untreated vascular endothelial cells Lane 2: vascular endothelial cells + control siRNA. Primary antibody was diluted 1:1000. Image ...read more
Immunocytochemistry/ Immunofluorescence: Occludin Antibody [NBP1-87402] - Methanol fixed, mouse choroid plexus cells were stained with Occludin antibody. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human breast cancer shows moderate membranous positivity in tumor cells.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human prostate cancer shows moderate membranous positivity in tumor cells.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human stomach shows moderate membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

Occludin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEED
Marker
Tight Junctions Marker
Specificity
Specificity of human Occludin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OCLN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Knockdown Validated
Application Notes
ICC/IF reported in scientific literature (PMID: 28848383), and a verified customer review. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Occludin antibody validated for WB from a verified customer review.
Control Peptide
Occludin Protein (NBP1-87402PEP)
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-87402 in the following applications:
Publications
Read Publications using
NBP1-87402 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 31715313). Mouse reactivity reported in (PMID: 30685438), and a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Occludin Antibody

  • BLCPMG
  • Occludin
  • OCLN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Tight Junction
Protein 1 Antibody
NBP1-85047
Knockout Validated: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and TJP1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:200 of Rabbit Anti-Human TJP1 Polyclonal Antibody (Catalog # NBP1-85047) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for TJP1 at approximately 260 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Analysis in human cell line A-431.
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Monolayer of Human ARPE-19 cells on a glass substrate. Tight Junction Protein 1 staining in red. Image from a verified customer review.
(4 Reviews)
(7 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
Claudin-1 Antibody
(1C5-D9)
H00009076-M01
Western Blot: Claudin-1 Antibody (1C5-D9) [H00009076-M01] - CLDN1 monoclonal antibody (M01), clone 1C5-D9. Analysis of CLDN1 expression in A-431.
Immunohistochemistry-Paraffin: Claudin-1 Antibody (1C5-D9) [H00009076-M01] - Analysis of monoclonal antibody to CLDN1 on formalin-fixed paraffin-embedded human colon. Antibody concentration 5 ug/ml.
Western Blot: Claudin-1 Antibody (1C5-D9) [H00009076-M01] - CLDN1 monoclonal antibody (M01), clone 1C5-D9. Analysis of CLDN1 expression in PRC/PRF/5.
(2 Reviews)
(24 Publications)
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, S-ELISA
Claudin-7 Antibody
(6-G3)
NBP2-66784
Western Blot: Claudin-7 Antibody (6-G3) [NBP2-66784] - Analysis on SW480 cell lysate using anti- CLDN7 mouse mAb.
Immunocytochemistry/Immunofluorescence: Claudin-7 Antibody (6-G3) [NBP2-66784] - Staining CLDN7 in SW480 cells (red). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Human Claudin-5
ELISA Kit (Colorimetr ...
NBP2-75332
Human Claudin-5 ELISA Kit (Colorimetric) - Standard Curve Reference
Species: Hu
Claudin-4 Antibody
NBP2-41187
Western Blot: Claudin-4 Antibody [NBP2-41187] - Western Blot Validation in Human Colon Tissue Lysate. Loading: 15 ug of lysates per lane. Antibodies: CLAUDIN4, NBP2-41187 (Lane 1: 1 ug/mL and Lane 2: 2 ug/mL), 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
Western Blot: Claudin-4 Antibody [NBP2-41187] - Independent Antibody Validation (IAV) via Protein Expression Profile in Human Cell Lines. Loading: 15 ug of lysates per lane. Antibodies: CLAUDIN4, NBP2-41187 (1 ug/mL), CLAUDIN4 from Company B (1 ug/mL), and beta-actin (1 ug/mL), 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
Western Blot: Claudin-4 Antibody [NBP2-41187] - Western Blot Validation in Human Cell Lines. Loading: 15 ug of lysates per lane.Antibodies: CLAUDIN4, NBP2-41187 (1 ug/mL), 1h incubation at RT in 5% NFDM/TBST. Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
(1 Publication)
Species: Hu
Applications: WB, ELISA, IF
E-Cadherin
Antibody [Unconjugate
AF748
E‑Cadherin was detected in immersion fixed D3 mouse embryonic stem cell line using Goat Anti-Human/MouseE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
E‑Cadherin was detected in perfusion fixed frozen sections of mouse skin using Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membranes in keratinocytes. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
E‑Cadherin was detected in immersion fixed mouse intestinal organoids using Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (green; Catalog # NL001) and counterstained with DAPI (blue). Magnification shown at 100X (upper panel) and 40X (lower panel). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(7 Reviews)
(34 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(31 Reviews)
(645 Publications)
Species: Hu
Claudin-3 Antibody
(385021) [Unconjugate ...
MAB4620
Claudin‑3 was detected in immersion fixed PC‑3 human prostate cancer cell line using Mouse Anti-Human Claudin‑3 Monoclonal Antibody (Catalog # MAB4620) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
PC‑3 human prostate cancer cell line was stained with Mouse Anti-Human Claudin‑3 Monoclonal Antibody (Catalog # MAB4620, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B).
Claudin‑3 was detected in immersion fixed paraffin-embedded sections of human colon array using Mouse Anti-Human Claudin‑3 Monoclonal Antibody (Catalog # MAB4620) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
VEGF [HRP]
DVE00
(25 Reviews)
(512 Publications)
Species: Hu
beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Activity of Wnt/beta-catenin pathway in the embryonic chick lung. Western blot analysis of active and total beta-catenin in stage b1, b2 and b3 lungs, and stage 24 limb (as positive control). Control loading was performed using beta-tubulin (55 kDa). Total and active beta-catenin correspond to 92 kDa. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0112388), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
(4 Reviews)
(11 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Synaptic
glycoprotein SC2 Anti
NBP2-49230
Western Blot: Synaptic glycoprotein SC2 Antibody [NBP2-49230] - Analysis in control (vector only transfected HEK293T lysate) and TECR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: Synaptic glycoprotein SC2 Antibody [NBP2-49230] - Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: Synaptic glycoprotein SC2 Antibody [NBP2-49230] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MMP-9 [HRP]
DMP900
(7 Reviews)
(164 Publications)
Species: Hu
MARVELD2 Antibody
NB100-74633
Western Blot: MARVELD2 Antibody [NB100-74633] - Detection of Human MARVELD2/Tricellulinon HeLa whole cell lysate using NB100-74633. MARVELD2/Tricellulin was also immunoprecipitated by rabbit anti-MARVELD2/Tricellulin antibody NB100-74632.
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
Flow (Intracellular): NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on THP-1 cells with NOD2 (2D9) antibody NB100-524AF488 (blue) and a matched isotype control NBP2-27287AF488 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes.
(1 Review)
(20 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).
Immunohistochemistry-Paraffin: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Formalin-fixed, paraffin-embedded human Tonsil stained with HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, CyTOF-ready
Tight Junction
Protein 2 Antibody
NBP1-86850
Western Blot: Tight Junction Protein 2 Antibody [NBP1-86850] - Analysis in human cell lines A-431 and SK-MEL-30 using anti-TJP2 antibody. Corresponding TJP2 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850] - Green: CD31 Red: Tight Junction Protein 2 Blue: Nuclei. Lung frozen section was blocked and stained with TJP-2 at 1:100 dilution for a hour. A secondary Alexa 555-conjugated goat anti-rabbit antibody was used for labeling. Section was aso co-stained with CD31 antibody in conjunction with an Alexa 488-conjugated antibody. Nuclei was revealed by DAPU staining. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Tight Junction Protein 2 Antibody [NBP1-86850] - Staining of human pancreas shows weak cytoplasmic psotivity in exocrine glandular cells.
(4 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Occludin Antibody (NBP1-87402)(11)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 4 applications: ICC/IF, IHC, IHC-P, WB.


Filter By Application
ICC/IF
(3)
IHC
(5)
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
Mouse
(5)
Rat
(1)
All Species
Showing Publications 1 - 10 of 11. Show All 11 Publications.
Publications using NBP1-87402 Applications Species
Heldt NA, Seliga A, Winfield M et al. Electronic cigarette exposure disrupts blood-brain barrier integrity and promotes neuroinflammation Brain Behav. Immun. Mar 31 2020 [PMID: 32243899] (IHC, Mouse) IHC Mouse
Shinde T, Perera AP, Vemuri R et al. Synbiotic supplementation with prebiotic green banana resistant starch and probiotic Bacillus coagulans spores ameliorates gut inflammation in mouse model of inflammatory bowel diseases Eur J Nutr Feb 17 2020 [PMID: 32067099] (IHC, Mouse) IHC Mouse
Shastri S, Shinde T, Sohal SS et al. Idebenone Protects against Acute Murine Colitis via Antioxidant and Anti-Inflammatory Mechanisms Int J Mol Sci Jan 12 2020 [PMID: 31940911] (IHC, Mouse) IHC Mouse
Evran S, Calis F, Akkaya E et al. The effect of high mobility group box-1 protein on cerebral edema, blood-brain barrier, oxidative stress and apoptosis in an experimental traumatic brain injury model Brain Res. Bull. Nov 9 2019 [PMID: 31715313] (IHC, Rat) IHC Rat
Messal N, Fernandez N, Dayot S et al. Ectopic expression of OX1R in ulcerative colitis mediates anti-inflammatory effect of orexin-A Biochimica et Biophysica Acta (BBA) - Molecular Basis of Disease Nov 1 2018 [PMID: 30251681] (WB, Mouse) WB Mouse
Mikula-Pietrasik J, Uruski P, Szubert S et al. Malignant ascites determine the transmesothelial invasion of ovarian cancer cells Int. J. Biochem. Cell Biol. 2017 Sep 06 [PMID: 28888784] (IHC-P, Human) IHC-P Human
Liu W, Schrott-Fischer A, Glueckert R et al. The Human Cochlear Battery - Claudin-11 Barrier and Ion Transport Proteins in the Lateral Wall of the Cochlea Front Mol Neurosci 2017 Aug 29 [PMID: 28848383] (ICC/IF, Human) ICC/IF Human
Baumann V Identification and manipulation of chromatin barriers in transcriptional reprogramming Thesis (ICC/IF) ICC/IF
Almassy J, Diszhazi G, Skaliczki M et al. Expression of BK channels and Na+-K+ pumps in the apical membrane of lacrimal acinar cells suggests a new molecular mechanism for primary tear-secretion. Ocul Surf Jan 24 2019 [PMID: 30685438] (ICC/IF, Mouse) ICC/IF Mouse
Rom S, Zuluaga-Ramirez V, Gajghate S et al. Hyperglycemia-Driven Neuroinflammation Compromises BBB Leading to Memory Loss in Both Diabetes Mellitus (DM) Type 1 and Type 2 Mouse Models. Mol. Neurobiol. Jul 5 2018 [PMID: 29974394] (IHC) IHC
Show All 11 Publications.

Reviews for Occludin Antibody (NBP1-87402) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Mouse.

Reviews using NBP1-87402:
Filter by Applications
WB
(1)
IF
(1)
All Applications
Filter by Species
Mouse
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot Occludin NBP1-87402
Enlarge 		5
reviewed by:
James Xiao
 WB Mouse 06/15/2017
View

Summary

ApplicationWestern Blot
Sample TestedPrimary lung endothelial cells
SpeciesMouse
LotB106982

Comments

CommentsMembrane was blocked in 5% milk in TBST. Primary antibody dilution was 1:1000 and the dilution for the secondary ab was 1:5000.
Immunofluorescence Occludin NBP1-87402
Enlarge 		4
reviewed by:
Anonymous
 IF Mouse 04/06/2015
View

Summary

ApplicationImmunofluorescence
Sample TestedMouse choroid plexus cells
SpeciesMouse

Blocking

Blocking DetailsScytek super block blocking reagent-1h-100%

Primary Anitbody

Dilution Ratio1:50 at room temperature for 1h

Secondary Antibody

Secondary DescriptionAlexafluor 488 anti-rabbit, 1h at room temperature
Secondary Concentration1:250

Details

Detection NotesImaged on Zeiss microscope. DAPI was used to image nuclei. EMbedding medium: Gelvatol
Fixation DetailsMethanol fixation, NP-40 permeabilization
Wash DescriptionPBS washes, 3 times.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Occludin Antibody (NBP1-87402) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Occludin Products

Bioinformatics Tool for Occludin Antibody (NBP1-87402)

Discover related pathways, diseases and genes to Occludin Antibody (NBP1-87402). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Occludin Antibody (NBP1-87402)

Discover more about diseases related to Occludin Antibody (NBP1-87402).
 

Pathways for Occludin Antibody (NBP1-87402)

View related products by pathway.

PTMs for Occludin Antibody (NBP1-87402)

Learn more about PTMs related to Occludin Antibody (NBP1-87402).

Blogs on Occludin

There are no specific blogs for Occludin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0
Western Blot Occludin NBP1-87402
Enlarge
 James Xiao
06/15/2017
Application: WB
Species: Mouse
read this review
Immunofluorescence Occludin NBP1-87402
Enlarge
 Anonymous
04/06/2015
Application: IF
Species: Mouse
read this review

Bioinformatics

Gene Symbol OCLN