Occludin Antibody

Images

 
Western Blot: Occludin Antibody [NBP1-87402] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Occludin Antibody [NBP1-87402] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cell junctions.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunocytochemistry/ Immunofluorescence: Occludin Antibody [NBP1-87402] - Methanol fixed, mouse choroid plexus cells were stained with Occludin antibody. Image from verified customer review.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Occludin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEED
Marker
Tight Junctions Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OCLN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Occludin Protein (NBP1-87402PEP)
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-87402 in the following applications:

Publications
Read Publications using
NBP1-87402 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Occludin Antibody

  • BLCPMG
  • Occludin
  • OCLN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB120-15106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-41187
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-49230
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-86850
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Occludin Antibody (NBP1-87402)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, IHC-P.


Filter By Application
ICC/IF
(1)
IHC-P
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for Occludin Antibody (NBP1-87402) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Mouse.
We have 2 reviews tested in 2 application: WB, IF.

Reviews using NBP1-87402:
Filter by Applications
WB
(1)
IF
(1)
All Applications
Filter by Species
Mouse
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot Occludin NBP1-87402
Enlarge
reviewed by:
Jim Hsiao
WB Mouse 06/15/2017
View

Summary

ApplicationWestern Blot
Sample TestedPrimary lung endothelial cells
SpeciesMouse
LotB106982

Comments

CommentsMembrane was blocked in 5% milk in TBST. Primary antibody dilution was 1:1000 and the dilution for the secondary ab was 1:5000.
Immunofluorescence Occludin NBP1-87402
Enlarge
reviewed by:
Anonymous
IF Mouse 04/06/2015
View

Summary

ApplicationImmunofluorescence
Sample TestedMouse choroid plexus cells
SpeciesMouse

Blocking

Blocking DetailsScytek super block blocking reagent-1h-100%

Primary Anitbody

Dilution Ratio1:50 at room temperature for 1h

Secondary Antibody

Secondary DescriptionAlexafluor 488 anti-rabbit, 1h at room temperature
Secondary Concentration1:250

Details

Detection NotesImaged on Zeiss microscope. DAPI was used to image nuclei. EMbedding medium: Gelvatol
Fixation DetailsMethanol fixation, NP-40 permeabilization
Wash DescriptionPBS washes, 3 times.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Occludin Antibody (NBP1-87402) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Occludin Products

Bioinformatics Tool for Occludin Antibody (NBP1-87402)

Discover related pathways, diseases and genes to Occludin Antibody (NBP1-87402). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Occludin Antibody (NBP1-87402)

Discover more about diseases related to Occludin Antibody (NBP1-87402).
 

Pathways for Occludin Antibody (NBP1-87402)

View related products by pathway.

PTMs for Occludin Antibody (NBP1-87402)

Learn more about PTMs related to Occludin Antibody (NBP1-87402).

Blogs on Occludin

There are no specific blogs for Occludin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0

Jim Hsiao
06/15/2017
Application: WB
Species: Mouse

Anonymous
04/06/2015
Application: IF
Species: Mouse

Bioinformatics

Gene Symbol OCLN
Entrez