Home » Occludin » Occludin Antibodies » Occludin Antibody

Occludin Antibody

 (15 Publications)
 (4 Reviews)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Occludin Antibody [NBP1-87402] - Analysis in human cell line CACO-2 and human cell line HeLa.
Orthogonal Strategies: Western Blot: Occludin Antibody [NBP1-87402] - Analysis in human cell line CACO-2 and human cell line HeLa.
Genetic Strategies: Western Blot: Occludin Antibody [NBP1-87402] - Lane 1: untreated vascular endothelial cells Lane 2: vascular endothelial cells + control siRNA. Primary antibody was diluted 1:1000. WB image ...read more
Immunocytochemistry/ Immunofluorescence: Occludin Antibody [NBP1-87402] - Staining of IEC-6 rat intestinal epithelial cells using Occludin antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human prostate shows negative membranous positivity in glandular cells as expected.
Immunocytochemistry/ Immunofluorescence: Occludin Antibody [NBP1-87402] - Methanol fixed, mouse choroid plexus cells were stained with Occludin antibody. ICC/IF image submitted by a verified customer review.
Immunocytochemistry/ Immunofluorescence: Occludin Antibody [NBP1-87402] - Staining of human cell line A-431 shows localization to plasma membrane & cell junctions. Antibody staining shown in green.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human breast cancer shows moderate membranous positivity in tumor cells.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human prostate cancer shows moderate membranous positivity in tumor cells.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human stomach shows moderate membranous positivity in glandular cells.
ELISA: Occludin Antibody [NBP1-87402] - Occludin levels in untreated and LPS treated rat intestinal tissues. ELISA image submitted by a verified customer review.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

  

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Occludin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEED
Marker
Tight Junctions Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OCLN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/mL
Application Notes
ICC/IF reported in scientific literature (PMID: 28848383), and a verified customer review. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Occludin antibody validated for WB and ELISA from a verified customer reviews.
Control Peptide
Occludin Protein (NBP1-87402PEP)
Reviewed Applications
Read 4 Reviews rated 4
using
NBP1-87402 in the following applications:
Publications
Read Publications using
NBP1-87402 in the following applications:

  • ICC/IF
    4 publications
  • IHC
    5 publications
  • IHC-P
    2 publications
  • WB
    2 publications

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 31715313). Mouse reactivity reported in (PMID: 30685438), and a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Occludin Antibody

  • BLCPMG
  • Occludin
  • OCLN

Background

The Occludin gene encodes an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Tight Junction
Protein 1 Antibody
NBP1-85047
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of Pig trabecular meshwork cells. ICC/IF image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human cell line U-2 OS shows localization to cytosol & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.
(5 Reviews)
(12 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Claudin-1 Antibody
(1C5-D9)
H00009076-M01
ELISA: Claudin-1 Antibody (1C5-D9) [H00009076-M01] - Detection limit for recombinant GST tagged CLDN1 is approximately 0.03ng/ml as a capture antibody.
Immunohistochemistry-Paraffin: Claudin-1 Antibody (1C5-D9) [H00009076-M01] - Analysis of monoclonal antibody to CLDN1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Immunohistochemistry-Paraffin: Claudin-1 Antibody (1C5-D9) [H00009076-M01] - Analysis of monoclonal antibody to CLDN1 on formalin-fixed paraffin-embedded human colon. Antibody concentration 5 ug/ml.
(2 Reviews)
(25 Publications)
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Claudin-7 Antibody
NBP2-97417
Immunocytochemistry/Immunofluorescence: Claudin-7 Antibody [NBP2-97417] - Immunofluorescence staining of Claudin-7 in MCF7 cells. Cells were fixed with 4% PFA, blocked with 10% serum, and incubated with rabbit anti-Human Claudin-7 polyclonal antibody (dilution ratio 1:200) at 4C overnight. Then cells were stained with the Alexa Fluor(R)488-conjugated Goat Anti-rabbit IgG Secondary antibody (green) and counterstained with DAPI (blue).Positive staining was localized to Cytoplasm.
Immunohistochemistry-Paraffin: Claudin-7 Antibody [NBP2-97417] - Staining of human Claudin-7 in human rectum with rabbit polyclonal antibody at 1:100 dilution.
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Claudin-5 Antibody
(OTI1G4)
NBP2-02259
Flow Cytometry: Claudin-5 Antibody (1G4) [NBP2-02259] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Claudin 5 antibody, and then analyzed by flow cytometry.
Immunocytochemistry/Immunofluorescence: Claudin-5 Antibody (1G4) [NBP2-02259] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Claudin 5.
Immunocytochemistry/Immunofluorescence: Claudin-5 Antibody (OTI1G4) [NBP2-02259] - Claudin-5 labeled pig SC cells visualized by alexa 594. ICC/IF image submitted by a verified customer review.
(1 Review)
Species: Hu, Mu, Po, Rt
Applications: Flow, ICC/IF
Claudin-4 Antibody
(382321) [Unconjugate ...
MAB4219
PC‑3 human prostate cancer cell line was stained with Mouse Anti-Human Claudin‑4 Monoclonal Antibody (Catalog # MAB4219, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram) followed by PE-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). View our protocol for Staining Membrane-associated Proteins.
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow
E-Cadherin
Antibody [Unconjugate
AF748
E‑Cadherin was detected in immersion fixed D3 mouse embryonic stem cell line using Goat Anti-Human/MouseE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
E‑Cadherin was detected in perfusion fixed frozen sections of mouse skin using Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membranes in keratinocytes. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
E‑Cadherin was detected in immersion fixed mouse intestinal organoids using Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (green; Catalog # NL001) and counterstained with DAPI (blue). Magnification shown at 100X (upper panel) and 40X (lower panel). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(55 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(3 Reviews)
(738 Publications)
Species: Hu
Applications: BA
Claudin-3 Antibody
(CL13130)
NBP3-18555
Immunocytochemistry/Immunofluorescence: Claudin-3 Antibody (CL13130) [NBP3-18555] - Staining of MCF-7 cells using the Anti-CLDN3 monoclonal antibody, showing specific staining in cell junctions in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Immunohistochemistry-Paraffin: Claudin-3 Antibody (CL13130) [NBP3-18555] - Analysis in human prostate and placenta tissues using NBP3-18555 antibody. Corresponding CLDN3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Claudin-3 Antibody (CL13130) [NBP3-18555] - Staining of human ovarian cancer (clear cell carcinoma) shows strong membranous positivity in tumor cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
VEGF [HRP]
DVE00
(621 Publications)
Species: Hu
Applications: ELISA
beta-Catenin
Antibody (12F7) - BSA
NBP1-54467
Flow Cytometry: beta-Catenin Antibody (12F7) [NBP1-54467] - An intracellular stain was performed on SK-MEL-28 cells with beta-Catenin Antibody [12F7] NBP1-54467B (blue) and a matched isotype control (orange). Both antibodies were conjugated to Biotin. Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Analysis of beta Catenin expression in 1) HepG2, 2) MCF7, and 3) Cos7 whole cell lysates using NBP1-54467.
Immunohistochemistry: beta-Catenin Antibody (12F7) [NBP1-54467] - IF beta-Catenin staining of mouse brain tissue. This image submitted by a verified customer review.
(4 Reviews)
(19 Publications)
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Synaptic
glycoprotein SC2 Anti
NBP2-49230
Western Blot: Synaptic glycoprotein SC2 Antibody [NBP2-49230] - Analysis in control (vector only transfected HEK293T lysate) and TECR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: Synaptic glycoprotein SC2 Antibody [NBP2-49230] - Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: Synaptic glycoprotein SC2 Antibody [NBP2-49230] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MMP-9 [HRP]
DMP900
(208 Publications)
Species: Hu
Applications: ELISA
MARVELD2 Antibody
NB100-74633
Western Blot: MARVELD2 Antibody [NB100-74633] - Detection of Human MARVELD2/Tricellulinon HeLa whole cell lysate using NB100-74633. MARVELD2/Tricellulin was also immunoprecipitated by rabbit anti-MARVELD2/Tricellulin antibody NB100-74632.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
ERK2 Antibody
(OTI6E5)
NBP1-47842
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Endometrium tissue within the normal limits using antiMAPK1mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min,Dilution 1:50)
Immunoprecipitation: ERK2 Antibody (6E5) [NBP1-47842] - TrueMab monoclonal anti-ERK2 antibody (Negative control: IP without adding anti-ERK2 antibody). For each experiment, 500ul of DDK tagged ERK2 overexpression lysates (at 1:5 dilution with HEK293T lysate), 2ug of antibody.
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-ERK2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(24 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Analysis of Protein Array containing more than 19,000 full-length human proteins using HLA DQ/DR/DP Antibody (HLA-Pan/2967R). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.
Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).
Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Tight Junction
Protein 2 Antibody
NBP1-86850
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850] - Staining of human cell line U-2 OS shows positivity in plasma membrane, cytoplasm and cell junctions. Antibody staining is shown in green.
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850] - Staining in primary mouse lung endothelial cells. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Tight Junction Protein 2 Antibody [NBP1-86850] - Staining of human testis shows strong membranous and cytoplasmic positivity in cells in seminiferous ducts.
(5 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for Occludin Antibody (NBP1-87402)(15)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 4 applications: ICC/IF, IHC, IHC-P, WB.


Filter By Application
ICC/IF
(4)
IHC
(5)
IHC-P
(2)
WB
(2)
All Applications
Filter By Species
Human
(4)
Mouse
(6)
Rat
(1)
All Species
Showing Publications 1 - 10 of 15. Show All 15 Publications.
Publications using NBP1-87402 Applications Species
Li Y, Wei JY, Liu H et al. An oxygen-adaptive interaction between SNHG12 and occludin maintains blood-brain barrier integrity Cell reports Apr 12 2022 [PMID: 35417709] (ICC/IF, Human) ICC/IF Human
Pretorius L, Van Staden ADP, Van der Merwe JJ et al. Alterations to microbial secretome by estrogen may contribute to sex bias in irritable bowel syndrome Inflammopharmacology Jan 13 2022 [PMID: 35022916]
Hua Q, Han Y, Zhao H et al. Punicalagin alleviates renal injury via the gut-kidney axis in high-fat diet-induced diabetic mice Food & function Jan 6 2022 [PMID: 34989745] (IHC-P) IHC-P
Delaney C, Farrell M, Doherty CP et al. Attenuated CSF-1R signalling drives cerebrovascular pathology EMBO molecular medicine Dec 22 2020 [PMID: 33350588] (WB, Human, Mouse) WB Human, Mouse
Heldt NA, Seliga A, Winfield M et al. Electronic cigarette exposure disrupts blood-brain barrier integrity and promotes neuroinflammation Brain Behav. Immun. Mar 31 2020 [PMID: 32243899] (IHC, Mouse) IHC Mouse
Shinde T, Perera AP, Vemuri R et al. Synbiotic supplementation with prebiotic green banana resistant starch and probiotic Bacillus coagulans spores ameliorates gut inflammation in mouse model of inflammatory bowel diseases Eur J Nutr Feb 17 2020 [PMID: 32067099] (IHC, Mouse) IHC Mouse
Shastri S, Shinde T, Sohal SS et al. Idebenone Protects against Acute Murine Colitis via Antioxidant and Anti-Inflammatory Mechanisms Int J Mol Sci Jan 12 2020 [PMID: 31940911] (IHC, Mouse) IHC Mouse
Almassy J, Diszhazi G, Skaliczki M et al. Expression of BK channels and Na+-K+ pumps in the apical membrane of lacrimal acinar cells suggests a new molecular mechanism for primary tear-secretion. Ocul Surf Jan 24 2019 [PMID: 30685438] (ICC/IF, Mouse) ICC/IF Mouse
Messal N, Fernandez N, Dayot S et al. Ectopic expression of OX1R in ulcerative colitis mediates anti-inflammatory effect of orexin-A Biochimica et Biophysica Acta (BBA) - Molecular Basis of Disease Nov 1 2018 [PMID: 30251681] (WB, Mouse) WB Mouse
Rom S, Zuluaga-Ramirez V, Gajghate S et al. Hyperglycemia-Driven Neuroinflammation Compromises BBB Leading to Memory Loss in Both Diabetes Mellitus (DM) Type 1 and Type 2 Mouse Models. Mol. Neurobiol. Jul 5 2018 [PMID: 29974394] (IHC) IHC
Show All 15 Publications.

Reviews for Occludin Antibody (NBP1-87402) (4) 44

Average Rating: 4
(Based on 4 reviews)
We have 4 reviews tested in 2 species: Mouse, Rat.

Reviews using NBP1-87402:
Filter by Applications
ICC
(1)
ELISA
(1)
WB
(1)
IF
(1)
All Applications
Filter by Species
Mouse
(2)
Rat
(2)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry Occludin NBP1-87402
Enlarge 		3
reviewed by:
Verified Customer
 ICC Rat 04/06/2022
View

Summary

ApplicationImmunocytochemistry
Sample TestedIEC-6 rat intestinal epithelial cells
SpeciesRat
Lot10666
ELISA Occludin NBP1-87402
Enlarge 		4
reviewed by:
Russ Tas
 ELISA Rat 06/01/2021
View

Summary

ApplicationELISA
Sample Testedrat intestine
SpeciesRat
Lot000010666
Western Blot Occludin NBP1-87402
Enlarge 		5
reviewed by:
Verified Customer
 WB Mouse 06/15/2017
View

Summary

ApplicationWestern Blot
Sample TestedPrimary lung endothelial cells
SpeciesMouse
LotB106982

Comments

CommentsMembrane was blocked in 5% milk in TBST. Primary antibody dilution was 1:1000 and the dilution for the secondary ab was 1:5000.
Immunofluorescence Occludin NBP1-87402
Enlarge 		4
reviewed by:
Nadine Bakkar
 IF Mouse 04/06/2015
View

Summary

ApplicationImmunofluorescence
Sample TestedMouse choroid plexus cells
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Occludin Antibody (NBP1-87402) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Occludin Products

Bioinformatics Tool for Occludin Antibody (NBP1-87402)

Discover related pathways, diseases and genes to Occludin Antibody (NBP1-87402). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Occludin Antibody (NBP1-87402)

Discover more about diseases related to Occludin Antibody (NBP1-87402).
 

Pathways for Occludin Antibody (NBP1-87402)

View related products by pathway.

PTMs for Occludin Antibody (NBP1-87402)

Learn more about PTMs related to Occludin Antibody (NBP1-87402).
 

Research Areas for Occludin Antibody (NBP1-87402)

Find related products by research area.

Blogs on Occludin

There are no specific blogs for Occludin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
1
4
2
3
1
2
0
1
0
Immunocytochemistry Occludin NBP1-87402
Enlarge
 Verified Customer
04/06/2022
Application: ICC
Species: Rat
read this review
ELISA Occludin NBP1-87402
Enlarge
 Russ Tas
06/01/2021
Application: ELISA
Species: Rat
read this review
Western Blot Occludin NBP1-87402
Enlarge
 Verified Customer
06/15/2017
Application: WB
Species: Mouse
read this review

Bioinformatics

Gene Symbol OCLN