Home » Occludin » Occludin Antibodies » Occludin Antibody

Occludin Antibody

 (3 Publications)
 (2 Reviews)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Occludin Antibody [NBP1-87402] - Lane 1: untreated vascular endothelial cells Lane 2: vascular endothelial cells + control siRNA. Primary antibody was diluted 1:1000. This image was submitted via customer Review.
Western Blot: Occludin Antibody [NBP1-87402] - Lane 1: untreated vascular endothelial cells Lane 2: vascular endothelial cells + control siRNA. Primary antibody was diluted 1:1000. This image was submitted via customer ...read more
Immunocytochemistry/ Immunofluorescence: Occludin Antibody [NBP1-87402] - Staining of human cell line A-431 shows localization to plasma membrane & cell junctions. Antibody staining shown in green.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human thyroid gland shows high expression.
Western Blot: Occludin Antibody [NBP1-87402] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Occludin Antibody [NBP1-87402] - Methanol fixed, mouse choroid plexus cells were stained with Occludin antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining in human thyroid gland and skeletal muscle tissues using anti-OCLN antibody. Corresponding OCLN RNA-seq data are ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Occludin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEED
Marker
Tight Junctions Marker
Specificity
Specificity of human, mouse Occludin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OCLN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Occludin Protein (NBP1-87402PEP)
Reviewed Applications
Read 2 Reviews rated 4.5
using
NBP1-87402 in the following applications:
Publications
Read Publications using
NBP1-87402 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (83%). Mouse reactivity per customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Occludin Antibody

  • BLCPMG
  • Occludin
  • OCLN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Tight Junction
Protein 1 Antibody
NBP1-85047
Knockout Validated: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and TJP1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:200 of Rabbit Anti-Human TJP1 Polyclonal Antibody (Catalog # NBP1-85047) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for TJP1 at approximately 260 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Analysis in human cell line A-431.
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human cell line U-2 OS shows localization to cytosol & cell junctions. Antibody staining is shown in green.
(4 Reviews)
(3 Publications)
Species: Hu, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
Claudin-1 Antibody
(1C5-D9)
H00009076-M01
Western Blot: Claudin-1 Antibody (1C5-D9) [H00009076-M01] - CLDN1 monoclonal antibody (M01), clone 1C5-D9. Analysis of CLDN1 expression in A-431.
Immunohistochemistry-Paraffin: Claudin-1 Antibody (1C5-D9) [H00009076-M01] - Analysis of monoclonal antibody to CLDN1 on formalin-fixed paraffin-embedded human colon. Antibody concentration 5 ug/ml.
Western Blot: Claudin-1 Antibody (1C5-D9) [H00009076-M01] - CLDN1 monoclonal antibody (M01), clone 1C5-D9. Analysis of CLDN1 expression in PRC/PRF/5.
(2 Reviews)
(20 Publications)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
Claudin-7 Antibody
NBP1-85683
Immunohistochemistry-Paraffin: Claudin-7 Antibody [NBP1-85683] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Claudin-7 Antibody [NBP1-85683] - Staining of human rectum shows high expression.
Immunohistochemistry-Paraffin: Claudin-7 Antibody [NBP1-85683] - Staining in human rectum and skeletal muscle tissues using anti-CLDN7 antibody. Corresponding CLDN7 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Claudin-5 Antibody
(OTI1G4)
NBP2-02259
Immunocytochemistry: Claudin-5 Antibody (1G4) [NBP2-02259] - Claudin-5 labeled pig SC cells visualized by alexa 594. This image was submitted via customer Review.
Flow Cytometry: Claudin-5 Antibody (1G4) [NBP2-02259] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Claudin 5 antibody, and then analyzed by flow cytometry.
Immunocytochemistry/Immunofluorescence: Claudin-5 Antibody (1G4) [NBP2-02259] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Claudin 5.
(1 Review)
Species: Hu, Po
Applications: Flow, ICC/IF, ICC
Claudin-4 Antibody
(382321) [Unconjugate ...
MAB4219
PC‑3 human prostate cancer cell line was stained with Mouse Anti-Human Claudin‑4 Monoclonal Antibody (Catalog # MAB4219, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram) followed by PE-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). View our protocol for Staining Membrane-associated Proteins.
Species: Hu
Applications: Flow, CyTOF-ready
E-Cadherin
Antibody [Unconjugate
AF748
Western blot shows lysates of A431 human epithelial carcinoma cell line, A549 human lung carcinoma cell line, HepG2 human hepatocellular carcinoma cell line, P19 mouse embryonal carcinoma cell line, and 4T1 mouse breast cancer cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for E‑Cadherin at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of 4T1 mouse breast cancer cell line, P19 mouse embryonal carcinoma cell line, A431 human epithelial carcinoma cell line, and MCF‑7 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for E‑Cadherin at approximately 128 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
E‑Cadherin was detected in immersion fixed D3 mouse embryonic stem cell line using Goat Anti-Human/MouseE‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF748) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
(5 Reviews)
(25 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(21 Reviews)
(528 Publications)
Species: Hu
Claudin-3 Antibody
(385021) [Unconjugate ...
MAB4620
Claudin‑3 was detected in immersion fixed paraffin-embedded sections of human colon array using Mouse Anti-Human Claudin‑3 Monoclonal Antibody (Catalog # MAB4620) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Claudin‑3 was detected in immersion fixed PC‑3 human prostate cancer cell line using Mouse Anti-Human Claudin‑3 Monoclonal Antibody (Catalog # MAB4620) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
PC‑3 human prostate cancer cell line was stained with Mouse Anti-Human Claudin‑3 Monoclonal Antibody (Catalog # MAB4620, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B).
(1 Publication)
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
Claudin-2 Antibody
NBP2-58264
Immunocytochemistry/Immunofluorescence: Claudin-2 Antibody [NBP2-58264] - Staining of human cell line CACO-2 shows localization to nucleoplasm & cell junctions. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF
beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
Immunohistochemistry: beta-Catenin Antibody (12F7) [NBP1-54467] - Beta-catening (green) was detected in human skin (psoriasis) using beta-catenin-FITC antibody (1:40) in PBS for 1 hour. Nuclei were stained with Dapi (blue). Image from verified customer review.
(3 Reviews)
(7 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
Synaptic
glycoprotein SC2 Anti
NBP2-49230
Western Blot: Synaptic glycoprotein SC2 Antibody [NBP2-49230] - Analysis in control (vector only transfected HEK293T lysate) and TECR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: Synaptic glycoprotein SC2 Antibody [NBP2-49230] - Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: Synaptic glycoprotein SC2 Antibody [NBP2-49230] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MARVELD2 Antibody
NB100-74633
Western Blot: MARVELD2 Antibody [NB100-74633] - Detection of Human MARVELD2/Tricellulinon HeLa whole cell lysate using NB100-74633. MARVELD2/Tricellulin was also immunoprecipitated by rabbit anti-MARVELD2/Tricellulin antibody NB100-74632.
(2 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC-Fr, IP
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(14 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(2 Reviews)
(1 Publication)
Species: Hu
HLA DQA1 Antibody
NBP1-84550
Western Blot: HLA DQA1 Antibody [NBP1-84550] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line Daudi.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human lung shows high expression.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Species: Hu
Applications: WB, IHC, IHC-P
Tight Junction
Protein 2 Antibody
NBP1-86850
Western Blot: Tight Junction Protein 2 Antibody [NBP1-86850] - Analysis in human cell lines A-431 and SK-MEL-30 using anti-TJP2 antibody. Corresponding TJP2 RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 2 Antibody [NBP1-86850] - Staining of human cell line U-2 OS shows positivity in plasma membrane, cytoplasm and cell junctions.
Immunohistochemistry-Paraffin: Tight Junction Protein 2 Antibody [NBP1-86850] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.
(3 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Occludin Antibody (NBP1-87402)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, IHC-P.


Filter By Application
ICC/IF
(1)
IHC-P
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for Occludin Antibody (NBP1-87402) (2) 4.52

Average Rating: 4.5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Mouse.

Reviews using NBP1-87402:
Filter by Applications
WB
(1)
IF
(1)
All Applications
Filter by Species
Mouse
(2)
All Species
Images Ratings Applications Species Date Details
Western Blot Occludin NBP1-87402
Enlarge
reviewed by:
Jim Hsiao
 WB Mouse 06/15/2017
View

Summary

ApplicationWestern Blot
Sample TestedPrimary lung endothelial cells
SpeciesMouse
LotB106982

Comments

CommentsMembrane was blocked in 5% milk in TBST. Primary antibody dilution was 1:1000 and the dilution for the secondary ab was 1:5000.
Immunofluorescence Occludin NBP1-87402
Enlarge
reviewed by:
Anonymous
 IF Mouse 04/06/2015
View

Summary

ApplicationImmunofluorescence
Sample TestedMouse choroid plexus cells
SpeciesMouse

Blocking

Blocking DetailsScytek super block blocking reagent-1h-100%

Primary Anitbody

Dilution Ratio1:50 at room temperature for 1h

Secondary Antibody

Secondary DescriptionAlexafluor 488 anti-rabbit, 1h at room temperature
Secondary Concentration1:250

Details

Detection NotesImaged on Zeiss microscope. DAPI was used to image nuclei. EMbedding medium: Gelvatol
Fixation DetailsMethanol fixation, NP-40 permeabilization
Wash DescriptionPBS washes, 3 times.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Occludin Antibody (NBP1-87402) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Occludin Antibody (NBP1-87402)

Discover related pathways, diseases and genes to Occludin Antibody (NBP1-87402). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Occludin Antibody (NBP1-87402)

Discover more about diseases related to Occludin Antibody (NBP1-87402).
 

Pathways for Occludin Antibody (NBP1-87402)

View related products by pathway.

PTMs for Occludin Antibody (NBP1-87402)

Learn more about PTMs related to Occludin Antibody (NBP1-87402).

Blogs on Occludin

There are no specific blogs for Occludin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.5
5
1
4
1
3
0
2
0
1
0
Western Blot Occludin NBP1-87402
Enlarge
 Jim Hsiao
06/15/2017
Application: WB
Species: Mouse
read this review
Immunofluorescence Occludin NBP1-87402
Enlarge
 Anonymous
04/06/2015
Application: IF
Species: Mouse
read this review

Bioinformatics

Gene Symbol OCLN