Occludin Antibody

Western Blot: Occludin Antibody [NBP1-87402] - Lane 1: untreated vascular endothelial cells Lane 2: vascular endothelial cells + control siRNA. Primary antibody was diluted 1:1000. Image submitted by a verified customer review.

Immunocytochemistry/Immunofluorescence: Occludin Antibody [NBP1-87402] - Staining of human cell line A-431 shows localization to plasma membrane & cell junctions. Antibody staining shown in green.

Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human stomach shows moderate membranous positivity in glandular cells.

Western Blot: Occludin Antibody [NBP1-87402] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: Occludin Antibody [NBP1-87402] - Methanol fixed, mouse choroid plexus cells were stained with Occludin antibody. Image submitted by a verified customer review.

Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human breast cancer shows moderate membranous positivity in tumor cells.

Immunohistochemistry-Paraffin: Occludin Antibody [NBP1-87402] - Staining of human prostate cancer shows moderate membranous positivity in tumor cells.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC, IHC-P, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Occludin Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEED
• Marker: Tight Junctions Marker
• Specificity: Specificity of human Occludin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OCLN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:1000
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Knockdown Validated
• Application Notes: ICC/IF reported in scientific literature (PMID: 28848383). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (83%). Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Occludin Antibody

• BLCPMG
• Occludin
• OCLN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Occludin Antibody (NBP1-87402)(6)

Publications using NBP1-87402

• Almassy J, Diszhazi G, Skaliczki M et al. Expression of BK channels and Na+-K+ pumps in the apical membrane of lacrimal acinar cells suggests a new molecular mechanism for primary tear-secretion. Ocul Surf Jan 24 2019 [PMID: 30685438] (ICC/IF, Mouse)
• Messal N, Fernandez N, Dayot S et al. Ectopic expression of OX1R in ulcerative colitis mediates anti-inflammatory effect of orexin-A Biochimica et Biophysica Acta (BBA) - Molecular Basis of Disease Nov 1 2018 [PMID: 30251681] (WB, Mouse)
• Rom S, Zuluaga-Ramirez V, Gajghate S et al. Hyperglycemia-Driven Neuroinflammation Compromises BBB Leading to Memory Loss in Both Diabetes Mellitus (DM) Type 1 and Type 2 Mouse Models. Mol. Neurobiol. Jul 5 2018 [PMID: 29974394] (IHC)
• Li H, Sun J, Du J et al. Clostridium butyricum exerts a neuroprotective effect in a mouse model of traumatic brain injury via the gut-brain axis. Neurogastroenterol Motil 2018 May [PMID: 29193450]
• Mikula-Pietrasik J, Uruski P, Szubert S et al. Malignant ascites determine the transmesothelial invasion of ovarian cancer cells Int. J. Biochem. Cell Biol. 2017 Sep 06 [PMID: 28888784] (IHC-P, Human)
• Liu W, Schrott-Fischer A, Glueckert R et al. The Human Cochlear Battery - Claudin-11 Barrier and Ion Transport Proteins in the Lateral Wall of the Cochlea Front Mol Neurosci 2017 Aug 29 [PMID: 28848383] (ICC/IF, Human)

Reviews for Occludin Antibody (NBP1-87402) (2)

Average Rating: 4.5

(Based on 2 reviews)

We have 2 reviews tested in 1 species: Mouse.

reviewed by: Jim Hsiao WB Mouse 06/15/2017

Summary

• Application: Western Blot
• Sample Tested: Primary lung endothelial cells
• Species: Mouse
• Lot: B106982

Comments

• Comments: Membrane was blocked in 5% milk in TBST. Primary antibody dilution was 1:1000 and the dilution for the secondary ab was 1:5000.

reviewed by: Anonymous IF Mouse 04/06/2015

Summary

• Application: Immunofluorescence
• Sample Tested: Mouse choroid plexus cells
• Species: Mouse

Blocking

• Blocking Details: Scytek super block blocking reagent-1h-100%

Primary Anitbody

• Dilution Ratio: 1:50 at room temperature for 1h

Secondary Antibody

• Secondary Description: Alexafluor 488 anti-rabbit, 1h at room temperature
• Secondary Concentration: 1:250

Details

• Detection Notes: Imaged on Zeiss microscope. DAPI was used to image nuclei. EMbedding medium: Gelvatol
• Fixation Details: Methanol fixation, NP-40 permeabilization
• Wash Description: PBS washes, 3 times.

Bioinformatics

• Gene Symbol: OCLN