JAM-C Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to JAM3(junctional adhesion molecule 3) The peptide sequence was selected from the N terminal of JAM3. Peptide sequence SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
JAM3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for JAM-C Antibody - BSA Free
Background
Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. JAM3, one member of the immunoglobulin superfamily, is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. JAM3 is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, S-ELISA, WB
Species: Hu, Mu
Applications: IHC, Neut, Simple Western, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, InhibCellGro, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: WB
Publications for JAM-C Antibody (NBP1-60096) (0)
There are no publications for JAM-C Antibody (NBP1-60096).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for JAM-C Antibody (NBP1-60096) (0)
There are no reviews for JAM-C Antibody (NBP1-60096).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for JAM-C Antibody (NBP1-60096) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional JAM-C Products
Research Areas for JAM-C Antibody (NBP1-60096)
Find related products by research area.
|
Blogs on JAM-C