Isopeptidase T/USP5 Antibody

Images

 
Western Blot: Isopeptidase T/USP5 Antibody [NBP1-83089] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: Isopeptidase T/USP5 Antibody [NBP1-83089] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Isopeptidase T/USP5 Antibody [NBP1-83089] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts.
Western Blot: Isopeptidase T/USP5 Antibody [NBP1-83089] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Isopeptidase T/USP5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YVDKLEKIFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQKEVQDGIAPRMFKALIGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Isopeptidase T/USP5 Protein (NBP1-83089PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Isopeptidase T/USP5 Antibody

  • Deubiquitinating enzyme 5
  • EC 3.1.2.15
  • EC 3.4.19.12
  • Isopeptidase T
  • IsoT
  • ISOTubiquitin carboxyl-terminal hydrolase 5
  • ubiquitin isopeptidase T
  • ubiquitin specific peptidase 5 (isopeptidase T)
  • ubiquitin specific protease 5 (isopeptidase T)
  • ubiquitin thioesterase 5
  • Ubiquitin thiolesterase 5
  • ubiquitin-specific protease-5 (ubiquitin isopeptidase T)
  • Ubiquitin-specific-processing protease 5
  • USP5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6008
Species: Hu, Mu, Rt
Applications: WB
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-47279
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
AF7760
Species: Hu, Mu, Rt
Applications: WB
H00009960-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-88117
Species: Hu
Applications: WB (-), WB, IHC, IHC-P, IP
NB100-513
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP1-48047
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-28730
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-652
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-45514
Species: Hu
Applications: WB, IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF

Publications for Isopeptidase T/USP5 Antibody (NBP1-83089) (0)

There are no publications for Isopeptidase T/USP5 Antibody (NBP1-83089).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Isopeptidase T/USP5 Antibody (NBP1-83089) (0)

There are no reviews for Isopeptidase T/USP5 Antibody (NBP1-83089). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Isopeptidase T/USP5 Antibody (NBP1-83089) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Isopeptidase T/USP5 Products

Bioinformatics Tool for Isopeptidase T/USP5 Antibody (NBP1-83089)

Discover related pathways, diseases and genes to Isopeptidase T/USP5 Antibody (NBP1-83089). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Isopeptidase T/USP5 Antibody (NBP1-83089)

Discover more about diseases related to Isopeptidase T/USP5 Antibody (NBP1-83089).
 

Pathways for Isopeptidase T/USP5 Antibody (NBP1-83089)

View related products by pathway.

PTMs for Isopeptidase T/USP5 Antibody (NBP1-83089)

Learn more about PTMs related to Isopeptidase T/USP5 Antibody (NBP1-83089).

Blogs on Isopeptidase T/USP5

There are no specific blogs for Isopeptidase T/USP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Isopeptidase T/USP5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP5
Entrez