hHR23b Antibody

Images

 
Western Blot: hHR23b Antibody [NBP1-89699] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: hHR23b Antibody [NBP1-89699] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: hHR23b Antibody [NBP1-89699] - Staining of human stomach shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

hHR23b Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VIEALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RAD23B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
hHR23b Protein (NBP1-89699PEP)
Publications
Read Publication using NBP1-89699.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23059775)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for hHR23b Antibody

  • HHR23B
  • HR23BUV excision repair protein RAD23 homolog B
  • P58
  • RAD23 (S. cerevisiae) homolog B
  • RAD23 homolog B (S. cerevisiae)
  • RAD23, yeast homolog of, B
  • XP-C repair complementing complex 58 kDa
  • XP-C repair complementing protein
  • XP-C repair-complementing complex 58 kDa protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52549
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC
NB100-477
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-48704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
MAB1058
Species: Hu
Applications: Flow, Block, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NB100-74611
Species: Hu
Applications: WB, IHC-P, IP
NB100-93321
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF8519
Species: Hu, Mu, Rt
Applications: WB
H00000902-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP1-32083
Species: Hu
Applications: WB, ICC/IF
AF3296
Species: Hu, Mu, Rt
Applications: WB
NB100-496
Species: Hu
Applications: WB, IHC-P, IP
NBP1-89699
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for hHR23b Antibody (NBP1-89699)(1)

Reviews for hHR23b Antibody (NBP1-89699) (0)

There are no reviews for hHR23b Antibody (NBP1-89699). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for hHR23b Antibody (NBP1-89699) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional hHR23b Products

Bioinformatics Tool for hHR23b Antibody (NBP1-89699)

Discover related pathways, diseases and genes to hHR23b Antibody (NBP1-89699). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hHR23b Antibody (NBP1-89699)

Discover more about diseases related to hHR23b Antibody (NBP1-89699).
 

Pathways for hHR23b Antibody (NBP1-89699)

View related products by pathway.

PTMs for hHR23b Antibody (NBP1-89699)

Learn more about PTMs related to hHR23b Antibody (NBP1-89699).
 

Research Areas for hHR23b Antibody (NBP1-89699)

Find related products by research area.

Blogs on hHR23b

There are no specific blogs for hHR23b, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our hHR23b Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD23B