USP1 Antibody

Images

 
Western Blot: USP1 Antibody [NBP1-85950] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950] - Staining of human bone marrow shows strong nuclear positivity in subsets of bone marrow poietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KATSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPSILSKFCSLGKITTNQGVKGQSKENECDP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
USP1 Protein (NBP1-85950PEP)
Publications
Read Publication using NBP1-85950.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for USP1 Antibody

  • Deubiquitinating Enzyme 1
  • EC 3.1.2.15
  • EC 3.4.19.12
  • hUBP
  • ubiquitin carboxyl terminal hydrolase 1
  • Ubiquitin Carboxyl-Terminal Hydrolase 1
  • ubiquitin specific peptidase 1
  • ubiquitin specific processing protease 1
  • ubiquitin specific protease 1
  • Ubiquitin Thioesterase 1
  • Ubiquitin thiolesterase 1
  • Ubiquitin-specific-processing protease 1
  • UBP
  • USP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF6008
Species: Hu, Mu, Rt
Applications: WB
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-81404
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92566
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47279
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02648
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-86425
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4377
Species: Hu, Mu
Applications: WB, ICC
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-57495
Species: Hu
Applications: WB, IP, PLA
E-504
Species: Hu
H00011026-M01
Species: Hu
Applications: WB, ELISA
MAB2476
Species: Hu
Applications: WB, IHC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85950
Species: Hu
Applications: WB, IHC, IHC-P

Publications for USP1 Antibody (NBP1-85950)(1)

Reviews for USP1 Antibody (NBP1-85950) (0)

There are no reviews for USP1 Antibody (NBP1-85950). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP1 Antibody (NBP1-85950) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USP1 Products

Bioinformatics Tool for USP1 Antibody (NBP1-85950)

Discover related pathways, diseases and genes to USP1 Antibody (NBP1-85950). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP1 Antibody (NBP1-85950)

Discover more about diseases related to USP1 Antibody (NBP1-85950).
 

Pathways for USP1 Antibody (NBP1-85950)

View related products by pathway.

PTMs for USP1 Antibody (NBP1-85950)

Learn more about PTMs related to USP1 Antibody (NBP1-85950).

Blogs on USP1

There are no specific blogs for USP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our USP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol USP1
Entrez