USP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950] - Analysis in human testis and pancreas tissues using NBP1-85950 antibody. Corresponding USP1 RNA-seq data are presented for the same tissues.

Western Blot: USP1 Antibody [NBP1-85950] - Analysis using Anti-USP1 antibody NBP1-85950 (A) shows similar pattern to independent antibody NBP2-55036 (B).

Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950] - Staining of human testis shows moderate nuclear positivity in cells in seminiferious ducts.

Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: USP1 Antibody [NBP1-85950] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

USP1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KATSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPSILSKFCSLGKITTNQGVKGQSKENECDP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: USP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  USP1 Protein (NBP1-85950PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for USP1 Antibody - BSA Free

• Deubiquitinating Enzyme 1
• EC 3.1.2.15
• EC 3.4.19.12
• hUBP
• ubiquitin carboxyl terminal hydrolase 1
• Ubiquitin Carboxyl-Terminal Hydrolase 1
• ubiquitin specific peptidase 1
• ubiquitin specific processing protease 1
• ubiquitin specific protease 1
• Ubiquitin Thioesterase 1
• Ubiquitin thiolesterase 1
• Ubiquitin-specific-processing protease 1
• UBP
• USP1

Background

USP1 encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. The protein specifically deubiquitinates a protein in the Fanconi anemia (FA) DNA repair pathway. Alternate transcriptional splice variants have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for USP1 Antibody (NBP1-85950)(1)

Publication using NBP1-85950

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: USP1