ISG20 Antibody - BSA Free

Western Blot: ISG20 Antibody [NBP3-35464] - Western blot analysis of various lysates using ISG20 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ISG20 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ISG20 Antibody - BSA Free (NBP3-35464) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human ISG20 (NP_002192.2).
  
  Sequence:
  MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ISG20
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 20 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ISG20 Antibody - BSA Free

• CD25
• Estrogen-regulated transcript 45 protein
• HEM45EC 3.1.13.1
• interferon stimulated exonuclease gene 20kDa
• interferon stimulated gene (20kD)
• interferon-stimulated gene 20 kDa protein
• Promyelocytic leukemia nuclear body-associated protein ISG20

Background

Exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. Degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. Involved in the antiviral function of IFN against RNA viruses

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ISG20