![Western Blot: Irisin/FNDC5 Antibody [NBP2-14024] - Analysis in control (vector only transfected HEK293T lysate) and fNDC5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/Irisin-FNDC5-Antibody-Western-Blot-NBP2-14024-img0004.jpg "Western Blot: Irisin/FNDC5 Antibody [NBP2-14024] - Analysis in control (vector only transfected HEK293T lysate) and fNDC5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGR NQQLR |
| Specificity | Specificity of human Irisin/FNDC5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FNDC5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-14024 | Applications | Species |
|---|---|---|
| Komolka K, Albrecht E, Schering L et al. Locus Characterization and Gene Expression of Bovine FNDC5: Is the Myokine Irisin Relevant in Cattle?. PLoS One 2014 [PMID: 24498244] |
Secondary Antibodies |
Isotype Controls |
PTMs for Irisin/FNDC5 Antibody (NBP2-14024)Learn more about PTMs related to Irisin/FNDC5 Antibody (NBP2-14024).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Staining of human testis shows positivity in cells in seminiferous ducts and in Leydig cells.](http://images.novusbio.com/fullsize2/Irisin-FNDC5-Antibody-Immunohistochemistry-Paraffin-NBP2-14024-img0009.jpg "Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Staining of human testis shows positivity in cells in seminiferous ducts and in Leydig cells.")
![Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Staining of human liver shows granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize2/Irisin-FNDC5-Antibody-Immunohistochemistry-Paraffin-NBP2-14024-img0006.jpg "Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Staining of human liver shows granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Staining of human skeletal muscle shows granular cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize2/Irisin-FNDC5-Antibody-Immunohistochemistry-Paraffin-NBP2-14024-img0007.jpg "Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Staining of human skeletal muscle shows granular cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Staining of human stomach shows positivity in glandular cells.](http://images.novusbio.com/fullsize2/Irisin-FNDC5-Antibody-Immunohistochemistry-Paraffin-NBP2-14024-img0008.jpg "Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Staining of human stomach shows positivity in glandular cells.")
![Western Blot: PGC1 alpha Antibody [NBP1-04676] - Total protein from human adipose and skeletal muscle tissue, HeLa and A431 cells lines was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-PGC1-alpha in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence](http://images.novusbio.com/fullsize2/PGC1-alpha-Antibody-Western-Blot-NBP1-04676-img0012.jpg)
![Immunohistochemistry-Paraffin: PGC1 alpha Antibody [NBP1-04676] - IHC analysis of PGC-1 alpha in mouse prostate using DAB with hematoxylin counterstain.](http://images.novusbio.com/fullsize2/PGC1-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-04676-img0008.jpg)
![Immunohistochemistry-Paraffin: PGC1 alpha Antibody [NBP1-04676] - IHC analysis of a formalin-fixed paraffin-embedded tissue section of mouse prostate using rabbit polyclonal PGC1 alpha antibody at 1:200 dilution. The antibody generated an expected strong nuclear (punctate in some cells) and a weak cytoplasmic staining in the glandular cells lining of tubule-alveolar gland.](http://images.novusbio.com/fullsize2/PGC1-alpha-Antibody-Immunohistochemistry-Paraffin-NBP1-04676-img0011.jpg)
![Immunohistochemistry-Paraffin: Complement Factor H Antibody (OX-24) [NBP1-50323] - Analysis of anti-Factor H antibody with human liver at concentration 20 ug/ml.](http://images.novusbio.com/fullsize2/Complement-Factor-H-Antibody-(OX-24)-Immunohistochemistry-Paraffin-NBP1-50323-img0001.jpg)
![Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)](http://images.novusbio.com/fullsize2/Insulin-Antibody-(E2-E3-(same-as-INS04))-Immunohistochemistry-Paraffin-NBP2-34260-img0002.jpg)
![SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]](http://images.novusbio.com/fullsize2/Insulin Antibody (E2-E3 (same as INS04))-SDS-Page-NBP2-34260-img0003.jpg)
![Western Blot: BIRC6 Antibody [NB300-264] - Detection of Human and Mouse BIRC6 by Western Blot. Samples: Whole cell lysate from HeLa, 293T, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-BIRC6 antibody NB300-264 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 seconds.](http://images.novusbio.com/fullsize2/BIRC6-Antibody-Western-Blot-NB300-264-img0012.jpg)
![Immunohistochemistry: BIRC6 Antibody [NB300-264] - Sample: FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti-BIRC6/Apollon used at a dilution of 1:5,000 (0.2ug/ml). Detection: DAB Coutnerstain: IHC Hematoxylin (blue)](http://images.novusbio.com/fullsize2/BIRC6-Antibody-Immunohistochemistry-NB300-264-img0008.jpg)
![Western Blot: BIRC6 Antibody [NB300-264] - Samples: A) Whole cell lysate (WCL) and S100 extract (S100) from HeLa cells. B) Whole cell lysate (10 mg) from HeLa cells. Chemiluminescence with an exposure time of 10 minutes. B) Immunoprecipitate was resolved by SDS-PAGE and stained with Coomassie Blue. The band that is BIRC6 was confirmed by mass spectrometry.](http://images.novusbio.com/fullsize2/BIRC6-Antibody-Western-Blot-NB300-264-img0001.jpg)
![Immunohistochemistry: FNDC4 Antibody (1B7) [NBP2-45691] - Analysis of Carcinoma of Human liver tissue.(Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)](http://images.novusbio.com/fullsize2/FNDC4-Antibody-(1B7)-Immunohistochemistry-NBP2-45691-img0006.jpg)
![Immunohistochemistry: FNDC4 Antibody (1B7) [NBP2-45691] - Analysis of Human prostate tissue within the normal limits using FNDC4 mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)](http://images.novusbio.com/fullsize2/FNDC4-Antibody-(1B7)-Immunohistochemistry-NBP2-45691-img0001.jpg)
![Immunohistochemistry: FNDC4 Antibody (1B7) [NBP2-45691] - Analysis of Human tonsil tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)](http://images.novusbio.com/fullsize2/FNDC4-Antibody-(1B7)-Immunohistochemistry-NBP2-45691-img0002.jpg)
![Western Blot: MYF-5 Antibody (OTI2G5) [NBP2-44245] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MYF5, (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MYF5](http://images.novusbio.com/fullsize2/MYF-5-Antibody-(OTI2G5)-Western-Blot-NBP2-44245-img0001.jpg)
![Immunohistochemistry-Paraffin: MYF-5 Antibody (OTI2G5) [NBP2-44245] - Carcinoma of Human prostate tissue using anti-MYF5 mouse monoclonal antibody. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)](http://images.novusbio.com/fullsize2/MYF-5-Antibody-(OTI2G5)-Immunohistochemistry-Paraffin-NBP2-44245-img0012.jpg)
![Immunohistochemistry-Paraffin: MYF-5 Antibody (OTI2G5) [NBP2-44245] - Human breast tissue within the normal limits using anti-MYF5 mouse monoclonal antibody. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)](http://images.novusbio.com/fullsize2/MYF-5-Antibody-(OTI2G5)-Immunohistochemistry-Paraffin-NBP2-44245-img0004.jpg)
![IL-7 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "IL-7 [Unconjugated]")
![Western Blot: Caspase-4 Antibody [NBP1-76602] - Analysis of Caspase 4 in Ramos cells with anti-Caspase 4 (NT) using NBP1-76602 at (A) 0.5 and (B) 1 ug/ml.](http://images.novusbio.com/fullsize2/Caspase-4-Antibody-Western-Blot-NBP1-76602-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: Caspase-4 Antibody [NBP1-76602] - Immunofluorescence of Caspase-4 in Mouse Spleen 100 cells with Caspase-4 antibody at 10 ug/mL.](http://images.novusbio.com/fullsize2/Caspase-4 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-76602-img0004.jpg)
![Immunohistochemistry-Paraffin: Caspase-4 Antibody [NBP1-76602] - Mouse spleen using caspase-4 antibody at 2 ug/ml.](http://images.novusbio.com/fullsize2/Caspase-4-Antibody-Immunohistochemistry-Paraffin-NBP1-76602-img0002.jpg)
![Western Blot: Fibronectin Antibody [NBP1-91258] - WB analysis of Fibronectin in NIH 3T3 cell lysate.](http://images.novusbio.com/fullsize/Fibronectin-Antibody-Western-Blot-NBP1-91258-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: Fibronectin Antibody [NBP1-91258] - NIH-3T3 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-Fibronectin at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/fullsize2/Fibronectin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91258-img0012.jpg)
![Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Feline corneal stromal cells. IHC-FR and IF (Alexa Fluor488) was performed using NBP1-91258 at 1:400 dilution. Image was captured by epifluorescent microscopy. Image from verified customer review.](http://images.novusbio.com/fullsize2/Fibronectin-Antibody-Immunohistochemistry-Frozen-NBP1-91258-img0013.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")