Home » Irisin/FNDC5 » FNDC5 Research Products » Irisin/FNDC5 Antibody

Irisin/FNDC5 Antibody

 (3 Publications)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Specific positive staining can be observed in a subpopulation of mouse gastric mucosa cells. Green is FNDC5. Image from verified customer review.
Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Specific positive staining can be observed in a subpopulation of mouse gastric mucosa cells. Green is FNDC5. Image from verified customer review.
Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Staining of human skeletal muscle shows granular cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Irisin/FNDC5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGR NQQLR
Specificity
Specificity of human Irisin/FNDC5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FNDC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.Use in Immunofluorescence reported in scientific literature (PMID:31614634). Irisin/FNDC5 antibody validated for IHC-P from a verified customer review.
Control Peptide
Irisin/FNDC5 Protein (NBP2-14024PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-14024 in the following applications:
Publications
Read Publications using
NBP2-14024 in the following applications:

  • IF
    2 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24498244). Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Irisin/FNDC5 Antibody

  • fibronectin type III domain containing 5
  • fibronectin type III domain-containing protein 5
  • FNDC5
  • FRCP2
  • FRCP2Fibronectin type III repeat-containing protein 2
  • Irisin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PGC1 alpha Antibody
NBP1-04676
Knockout Validated: PGC1 alpha Antibody [NBP1-04676] - Western blot shows lysates of A431 human squamous carcinoma parental cell line and PGC1 alpha knockout (KO) A431 cell line. PVDF membrane was probed with 1:1000 of Rabbit Polyclonal PGC1 alpha Antibody (Catalog # NBP1-04676) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for PGC1 alpha at approximately 105 kDa (as indicated) in the parental A431 cell line, but is not detectable in the knockout A431 cell line. This experiment was conducted under reducing conditions.
Western Blot: PGC1 alpha Antibody [NBP1-04676] - Total protein from human adipose and skeletal muscle tissue, HeLa and A431 cells lines was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/mL PGC1 alpha Antibody (Molecular weight: 91 KDa) in 1% non-fat milk in TBST and detected with an anti-rabbit HRP secondary antibody using chemiluminescence
Immunohistochemistry-Paraffin: PGC1 alpha Antibody [NBP1-04676] - Analysis of PGC1 alpha Antibody in mouse prostate using DAB with hematoxylin counterstain.
(11 Reviews)
(134 Publications)
Species: Hu, Mu, Rt, Po, Gt, Ha, Sq
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC, KO
UCP1 Antibody
(536435) [Unconjugate
MAB6158
Western blot shows lysates of mouse brown adipose tissue and mouse adipose tissue. PVDF Membrane was probed with 0.5 µg/mL of Mouse Anti-Human/Mouse UCP1 Monoclonal Antibody (Catalog # MAB6158) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for UCP1 at approximately 33 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Western blot shows recombinant human UCP1, recombinant human UCP2, recombinant human UCP3, and recombinant human UCP4 (5 ng/lane). PVDF Membrane was probed with 0.5 µg/mL of Mouse Anti-Human/Mouse UCP1 Monoclonal Antibody (Catalog # MAB6158) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Simple Western lane view shows lysates of mouse adipose tissue and mouse brown adipose tissue, loaded at 0.5 mg/mL. A specific band was detected for UCP1 at approximately 37 kDa (as indicated) using 2.5 µg/mL of Mouse Anti-Human/Mouse UCP1 Monoclonal Antibody (Catalog # MAB6158). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(2 Reviews)
(9 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ICC, ICFlow
Granzyme A
Antibody [Unconjugate
AF2905
Granzyme A was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) using Goat Anti-Human Granzyme A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2905) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Recombinant Human Granzyme A protein was serially diluted 2-fold and captured by Mouse Anti-Human Granzyme A Monoclonal Antibody (Catalog # MAB29052) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human Granzyme A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2905) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Western blot shows lysates of NK‑92 human natural killer lymphoma cell line. PVDF membrane was probed with 0.25 µg/mL of Goat Anti-Human Granzyme A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2905) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Granzyme A at approximately 28 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB, ELISA, ICC
Complement Factor
H Antibody [Unconjuga ...
AF4779
Complement Factor H was detected in immersion fixed paraffin-embedded sections of human liver using Goat Anti-Human Complement Factor H Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4779) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
Species: Hu
Applications: WB, IHC
Ghrelin Antibody
(883622)
MAB8200
Ghrelin was detected in immersion fixed frozen sections of mouse stomach using Rat Anti-Human/Mouse Ghrelin Monoclonal Antibody (Catalog # MAB8200) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining is shown at both 60x magnification (upper panel) and 20x magnification (lower panel). Staining was localized to cytoplasm and gastric endocrine cells, respectively. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Ghrelin was detected in immersion fixed paraffin-embedded sections of human stomach using Rat Anti-Human/Mouse Ghrelin Monoclonal Antibody (Catalog # MAB8200) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS017) and counterstained with hematoxylin (blue). Specific staining was localized to glandular epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Publications)
Species: Hu, Mu
Applications: IHC
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(1 Publication)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Adiponectin/Acrp30
[HRP]
DRP300
(3 Reviews)
(117 Publications)
Species: Hu
BIRC6 Antibody
NB110-40730
Western Blot: BIRC6 Antibody [NB110-40730] - Dual IAP-targeting ASOs knockdown BIRC6, cIAP1 or survivin proteins and lead to marked suppression of CRPC cell proliferation. Western blotting showing protein levels of BIRC6, cIAP1 and survivin in two CRPC cell lines (A) PC-3 cells and (B) C4-2 cells transfected with Mock or increasing dosages of scrambled ASO (Scrb), dASOs 6w2 and 6w5 for 72 hr. Image collected and cropped by CiteAb from the following publication (http://www.oncotarget.com/fulltext/2229), licensed under a CC-BY licence.
Immunohistochemistry: BIRC6 Antibody [NB110-40730] - Treatments with dASOs resulted in significant lower viable tumor volume. Representative images of control ASO-6w2- and 6w5-treated PC-3 xenografts using H&E, and IHC staining of BIRC6, cleaved-caspase 3 and Ki-67. 20x magnification. Image collected and cropped by CiteAb from the following publication (http://www.oncotarget.com/fulltext/2229), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: BIRC6 Antibody [NB110-40730] - FFPE section of human metastatic lymph node. Antibody: Affinity purified rabbitanti-BIRC6/Apollon used at a dilution of 1:250. Detection: DAB
(5 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
FNDC4 Antibody
(OTI1B7)
NBP2-45691
Immunohistochemistry: FNDC4 Antibody (1B7) [NBP2-45691] - Analysis of Carcinoma of Human liver tissue.(Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: FNDC4 Antibody (1B7) [NBP2-45691] - Analysis of Human prostate tissue within the normal limits using FNDC4 mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: FNDC4 Antibody (1B7) [NBP2-45691] - Analysis of Human tonsil tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Species: Hu
Applications: IHC, IHC-P
PRDM16/MEL1
Antibody [Unconjugate
AF6295
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse PRDM16 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6295) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for PRDM16 at approximately 170 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
PRDM16 was detected in immersion fixed frozen sections of mouse embryo (E13.5) using Sheep Anti-Human/Mouse PRDM16 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6295) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (orange, upper panel; Catalog # NL010) and counterstained with DAPI (blue, lower panel). Specific staining was localized to the trigeminal ganglion. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: WB, IHC
MYF-5 Antibody
(593128) [Unconjugate
MAB4027
C2C12 mouse myoblast cell line was stained with Mouse Anti-Human/Mouse MYF‑5 Monoclonal Antibody (Catalog # MAB4027, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
MYF‑5 was detected in immersion fixed C2C12 mouse myoblast cell line using Mouse Anti-Human/Mouse MYF‑5 Monoclonal Antibody (Catalog # MAB4027) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red, upper panel; Catalog # NL007) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
LIF Antibody
(39N7D10)
NBP2-27406
Western Blot: LIF Antibody (39N7D10) [NBP2-27406] - LIF expression in human primary T-cells and cancer cell lines: Jurkat and K562. Image from verified customer review.
Immunohistochemistry-Paraffin: LIF Antibody (39N7D10) [NBP2-27406] - Tissue section of mouse brain using 5 ug/ml concentration of LIF antibody (clone 39N7D10).
Western Blot: LIF Antibody (39N7D10) [NBP2-27406] - WB validation of LIF antibody (clone 39N7D10) on (A) full-length recombinant Lif protein, (B) mouse spleen lysate and (C) human spleen lysate. 3 ug/mL concentration of primary antibody, Goat anti-rat IgG HRP secondary antibody and PicoTect ECL substrate solution were used for this assay.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
BDNF [HRP]
DBD00
(4 Reviews)
(53 Publications)
Species: Hu
IL-7 [Unconjugated]
207-IL
IL-7 [Unconjugated]
(8 Reviews)
(130 Publications)
Species: Hu
IL-6 [HRP]
D6050
(25 Reviews)
(465 Publications)
Species: Hu
GDF-8/Myostatin
[Unconjugated]
788-G8/CF
1 μg/lane of Recombinant Human/Mouse/Rat GDF-8/Myostatin was resolved withSDS-PAGE under reducing (R) andnon-reducing (NR) conditions and visualized by silver staining, showing the main bands at 12 kDa and 24 kDa, respectively.
Recombinant Human/Mouse/Rat GDF-8/Myostatin (Catalog # 788-G8/CF) induces hemoglobin expression in the K562 human chronic myelogenous leukemia cell line. The ED50 for this effect is 2-10 ng/mL.
(37 Publications)
Species: Hu, Mu, Rt
Caspase-11
Antibody (17D9)
NB120-10454
Western Blot: Caspase-11 Antibody (17D9) [NB120-10454] - Mouse liver extract was separated on a 4-15% gel and transfered to PVDF membrane. The membrane was probed with anti-caspase 11 antibody and detected with an anti-rat HRP secondary antibody. Both procaspase 11 and fully cleaved caspase 11 are detected.
Immunohistochemistry-Paraffin: Caspase-11 Antibody (17D9) [NB120-10454] - IHC-P analysis of a formalin fixed paraffin embedded tissue section of mouse lung using Caspase 11 antibody (clone 17D9) at 1:100 diluton. The antibody generated cytoplasmic signal with more intense staining in the bronchiolar epithelium while the staining signal in alveolar cells was relatively low.
Western Blot: Caspase-11 Antibody (17D9) [NB120-10454] - Analysis of Caspase-11 in THP-1 cell lysates that were untreated (left lane) or treated (right lane) with 100 ng/ml LPS. Image from verified customer review.
(6 Reviews)
(47 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, KD, KO
FGF
basic/FGF2/bFGF [Unco
233-FB/CF
Recombinant Human FGF basic/FGF2/bFGF (146 aa) (Catalog # 233-FB/CF) stimulates cell proliferation of the NR6R‑3T3 mouse fibroblast cell line. The activity is approximately 3-fold greater than the top competitor's FGF basic (146 aa).
1 µg/lane of Recombinant Human FGF basic/FGF2/bFGF (146 aa) was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(369 Publications)
Species: Hu
Fibronectin
Antibody
NBP1-91258
Western Blot: Fibronectin Antibody [NBP1-91258] - VSOP observed in perivascular-restricted spinal cord lesions with intact BBB. Immunostaining for laminin (brown) shows vascular endothelium and glia limitans of a perivascular lesion, along with infiltrating cells and VSOP (blue). Image collected and cropped by CiteAb from the following publication (http://asn.sagepub.com/lookup/doi/10.1042/AN20120081), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Fibronectin Antibody [NBP1-91258] - NIH-3T3 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-Fibronectin at 2 ug/mL overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at 1:500. Alpha tubulin (DM1A) NB100-690 was used as a co-stain at 1:1000 and detected with an anti-mouse DyLight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Analysis in a 6 month old Alport mouse kidney. Image from a verified customer review.
(11 Reviews)
(30 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Irisin/FNDC5
Antibody
NBP2-14024
Irisin/FNDC5 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, ICC/IF

Publications for Irisin/FNDC5 Antibody (NBP2-14024)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IF.


Filter By Application
IF
(2)
All Applications
Filter By Species
Human
(2)
All Species

Review for Irisin/FNDC5 Antibody (NBP2-14024) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP2-14024:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Irisin/FNDC5 NBP2-14024
Enlarge 		5
reviewed by:
Anonymous
 IHC-P Mouse 01/23/2019
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedStomach tissue
SpeciesMouse
LotA96720

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Irisin/FNDC5 Antibody (NBP2-14024) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Irisin/FNDC5 Products

Bioinformatics Tool for Irisin/FNDC5 Antibody (NBP2-14024)

Discover related pathways, diseases and genes to Irisin/FNDC5 Antibody (NBP2-14024). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Irisin/FNDC5 Antibody (NBP2-14024)

Discover more about diseases related to Irisin/FNDC5 Antibody (NBP2-14024).
 

Pathways for Irisin/FNDC5 Antibody (NBP2-14024)

View related products by pathway.

PTMs for Irisin/FNDC5 Antibody (NBP2-14024)

Learn more about PTMs related to Irisin/FNDC5 Antibody (NBP2-14024).

Blogs on Irisin/FNDC5

There are no specific blogs for Irisin/FNDC5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Immunohistochemistry-Paraffin Irisin/FNDC5 NBP2-14024
Enlarge
 Anonymous
01/23/2019
Application: IHC-P
Species: Mouse
read this review

Bioinformatics

Gene Symbol FNDC5