Irisin/FNDC5 Antibody

Images

 
Western Blot: Irisin/FNDC5 Antibody [NBP2-14024] - Analysis in control (vector only transfected HEK293T lysate) and fNDC5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Irisin/FNDC5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGR NQQLR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FNDC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Irisin/FNDC5 Protein (NBP2-14024PEP)
Publications
Read Publication using NBP2-14024.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24498244)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Irisin/FNDC5 Antibody

  • fibronectin type III domain containing 5
  • fibronectin type III domain-containing protein 5
  • FNDC5
  • FRCP2
  • FRCP2Fibronectin type III repeat-containing protein 2
  • Irisin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
AF4779
Species: Hu
Applications: WB, IHC
MAB8200
Species: Hu, Mu
Applications: IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-264
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-45691
Species: Hu
Applications: IHC
AF6295
Species: Hu, Mu
Applications: WB, IHC
NBP2-44245
Species: Hu
Applications: WB, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-76602
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Irisin/FNDC5 Antibody (NBP2-14024)(1)

Reviews for Irisin/FNDC5 Antibody (NBP2-14024) (0)

There are no reviews for Irisin/FNDC5 Antibody (NBP2-14024). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Irisin/FNDC5 Antibody (NBP2-14024) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Irisin/FNDC5 Products

Bioinformatics Tool for Irisin/FNDC5 Antibody (NBP2-14024)

Discover related pathways, diseases and genes to Irisin/FNDC5 Antibody (NBP2-14024). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Irisin/FNDC5 Antibody (NBP2-14024)

Discover more about diseases related to Irisin/FNDC5 Antibody (NBP2-14024).
 

Pathways for Irisin/FNDC5 Antibody (NBP2-14024)

View related products by pathway.

PTMs for Irisin/FNDC5 Antibody (NBP2-14024)

Learn more about PTMs related to Irisin/FNDC5 Antibody (NBP2-14024).

Blogs on Irisin/FNDC5

There are no specific blogs for Irisin/FNDC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Irisin/FNDC5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FNDC5
Entrez