Irisin/FNDC5 Antibody


Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Staining of human testis shows positivity in cells in seminiferous ducts and in Leydig cells.
Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Staining of human liver shows granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Staining of human skeletal muscle shows granular cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Staining of human stomach shows positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

Irisin/FNDC5 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGR NQQLR
Specificity of human Irisin/FNDC5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Irisin/FNDC5 Protein (NBP2-14024PEP)
Read Publication using NBP2-14024.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24498244)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Irisin/FNDC5 Antibody

  • fibronectin type III domain containing 5
  • fibronectin type III domain-containing protein 5
  • FNDC5
  • FRCP2
  • FRCP2Fibronectin type III repeat-containing protein 2
  • Irisin


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu, Mu
Applications: WB, Simple Western, ICC, ICFlow
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, ELISA, Flow, IHC-P, IP
Species: Hu
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Mu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Irisin/FNDC5 Antibody (NBP2-14024)(1)

Reviews for Irisin/FNDC5 Antibody (NBP2-14024) (0)

There are no reviews for Irisin/FNDC5 Antibody (NBP2-14024). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Irisin/FNDC5 Antibody (NBP2-14024) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Irisin/FNDC5 Antibody (NBP2-14024)

Discover related pathways, diseases and genes to Irisin/FNDC5 Antibody (NBP2-14024). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Irisin/FNDC5 Antibody (NBP2-14024)

Discover more about diseases related to Irisin/FNDC5 Antibody (NBP2-14024).

Pathways for Irisin/FNDC5 Antibody (NBP2-14024)

View related products by pathway.

PTMs for Irisin/FNDC5 Antibody (NBP2-14024)

Learn more about PTMs related to Irisin/FNDC5 Antibody (NBP2-14024).

Blogs on Irisin/FNDC5

There are no specific blogs for Irisin/FNDC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Irisin/FNDC5 Antibody and receive a gift card or discount.


Gene Symbol FNDC5