Irisin/FNDC5 Antibody

Images

 
Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Specific positive staining can be observed in a subpopulation of mouse gastric mucosa cells. Green is FNDC5. Image from verified customer review.
Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Staining of human skeletal muscle shows granular cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Irisin/FNDC5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGR NQQLR
Specificity
Specificity of human Irisin/FNDC5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FNDC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.Use in Immunofluorescence reported in scientific literature (PMID:31614634). Irisin/FNDC5 antibody validated for IHC-P from a verified customer review.
Control Peptide
Irisin/FNDC5 Protein (NBP2-14024PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-14024 in the following applications:

Publications
Read Publications using
NBP2-14024 in the following applications:

  • IF
    2 publications

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24498244). Mouse reactivity reported from a verified customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Irisin/FNDC5 Antibody

  • fibronectin type III domain containing 5
  • fibronectin type III domain-containing protein 5
  • FNDC5
  • FRCP2
  • FRCP2Fibronectin type III repeat-containing protein 2
  • Irisin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-04676
Species: Hu, Mu, Rt, Po, Gt, Ha, Sq
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC, KO
MAB6158
Species: Hu, Mu
Applications: WB, Simple Western, ICC, ICFlow
AF2905
Species: Hu
Applications: WB, ELISA, ICC
AF4779
Species: Hu
Applications: WB, IHC
MAB8200
Species: Hu, Mu
Applications: IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-40730
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45691
Species: Hu
Applications: IHC, IHC-P
AF6295
Species: Hu, Mu
Applications: WB, IHC
MAB4027
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-27406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-10454
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, KD, KO
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14024
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, ICC/IF

Publications for Irisin/FNDC5 Antibody (NBP2-14024)(3)

Review for Irisin/FNDC5 Antibody (NBP2-14024) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP2-14024:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Irisin/FNDC5 NBP2-14024
Enlarge
5
reviewed by:
Anonymous
IHC-P Mouse 01/23/2019
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedStomach tissue
SpeciesMouse
LotA96720

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Irisin/FNDC5 Antibody (NBP2-14024) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Irisin/FNDC5 Products

Bioinformatics Tool for Irisin/FNDC5 Antibody (NBP2-14024)

Discover related pathways, diseases and genes to Irisin/FNDC5 Antibody (NBP2-14024). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Irisin/FNDC5 Antibody (NBP2-14024)

Discover more about diseases related to Irisin/FNDC5 Antibody (NBP2-14024).
 

Pathways for Irisin/FNDC5 Antibody (NBP2-14024)

View related products by pathway.

PTMs for Irisin/FNDC5 Antibody (NBP2-14024)

Learn more about PTMs related to Irisin/FNDC5 Antibody (NBP2-14024).

Blogs on Irisin/FNDC5

There are no specific blogs for Irisin/FNDC5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
01/23/2019
Application: IHC-P
Species: Mouse

Bioinformatics

Gene Symbol FNDC5