Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Specific positive staining can be observed in a subpopulation of mouse gastric mucosa cells. Green is FNDC5. Image from verified customer review.
Immunohistochemistry-Paraffin: Irisin/FNDC5 Antibody [NBP2-14024] - Staining of human skeletal muscle shows granular cytoplasmic positivity in myocytes.
Western Blot: Irisin/FNDC5 Antibody [NBP2-14024] - Comparison of Irisin/FNDC5 expression levels detected by Western blot in Normal Human Keratinocytes (HaCat) and Larynx Epidermoid Carcinoma 2 (HEp-2) (A). The mean ...read more
Comparison of irisin expression levels detected by Western blot in Normal Human Keratinocytes (HaCat) and Larynx Epidermoid Carcinoma 2 (HEp-2) (A). The mean value of the densitometric optical analysis of the 3 repeats ...read more
Immunohistochemistry: Irisin/FNDC5 Antibody [NBP2-14024] - Comparison of irisin expression using immunohistochemistry (IHC; positive reactions—brown cell cytoplasm) in control tissue (A) & at different grades of ...read more
Immunohistochemistry: Irisin/FNDC5 Antibody [NBP2-14024] - Positive immunohistochemical (IHC) reactions (brown color) indicating strong irisin expression in the apical parts of cancer cells & vesicles; magnification ...read more
Immunohistochemistry: Irisin/FNDC5 Antibody [NBP2-14024] - Comparison of irisin expression using immunohistochemistry (IHC; positive reactions—brown cell cytoplasm) in control tissue (A) & at different grades of ...read more
Immunohistochemistry: Irisin/FNDC5 Antibody [NBP2-14024] - Comparison of irisin expression using immunohistochemistry (IHC; positive reactions—brown cell cytoplasm) in control tissue (A) & at different grades of ...read more
Immunohistochemistry: Irisin/FNDC5 Antibody [NBP2-14024] - Comparison of irisin expression using immunohistochemistry (IHC; positive reactions—brown cell cytoplasm) in control tissue (A) & at different grades of ...read more
Immunohistochemistry: Irisin/FNDC5 Antibody [NBP2-14024] - Comparison of irisin expression using immunohistochemistry (IHC; positive reactions—brown cell cytoplasm) in control tissue (A) & at different grades of ...read more
Western Blot: Irisin/FNDC5 Antibody [NBP2-14024] - Comparison of irisin expression levels detected by Western blot in Normal Human Keratinocytes (HaCat) & Larynx Epidermoid Carcinoma 2 (HEp-2) (A). The mean value of the ...read more
Immunohistochemistry: Irisin/FNDC5 Antibody [NBP2-14024] - Comparison of irisin expression using immunohistochemistry (IHC; positive reactions—brown cell cytoplasm) in control tissue (A) & at different grades of ...read more
Novus Biologicals Rabbit Irisin/FNDC5 Antibody - BSA Free (NBP2-14024) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Irisin/FNDC5 Antibody: Cited in 7 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: EDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKEMGRNQQLR
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FNDC5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Mouse reactivity reported from a verified customer review.
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for Irisin/FNDC5 Antibody - BSA Free
fibronectin type III domain containing 5
fibronectin type III domain-containing protein 5
FNDC5
FRCP2
FRCP2Fibronectin type III repeat-containing protein 2
Irisin
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.