IRF6 Antibody - BSA Free

Immunohistochemistry-Paraffin: IRF6 Antibody [NBP2-49383] - Staining in human breast and pancreas tissues using anti-IRF6 antibody. Corresponding IRF6 RNA-seq data are presented for the same tissues.

Western Blot: IRF6 Antibody [NBP2-49383] - Analysis using Anti-IRF6 antibody NBP2-49383 (A) shows similar pattern to independent antibody NBP2-55961 (B).

Immunocytochemistry/Immunofluorescence: IRF6 Antibody [NBP2-49383] - Staining of human cell line HaCaT shows localization to nucleus, cytosol & cell junctions. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: IRF6 Antibody [NBP2-49383] - Staining of human breast shows high expression.

Immunohistochemistry-Paraffin: IRF6 Antibody [NBP2-49383] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IRF6 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IRF6 Antibody - BSA Free (NBP2-49383) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-IRF6 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KSREFNLMYDGTKEVPMNPVKIYQVCDIPQPQGSIINPGSTGSAPWDEKDNDVDEE
• Predicted Species: Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IRF6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  IRF6 Recombinant Protein Antigen (NBP2-49383PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IRF6 Antibody - BSA Free

• interferon regulatory factor 6
• IRF6
• IRF-6
• LPS
• OFC6
• OFC6PPS
• PIT
• PPS
• Van der Woude syndrome
• VWS
• VWS1

Background

IRF6 encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IRF6 Antibody (NBP2-49383)(2)

Publications using NBP2-49383

• Parisi L, Mockenhaupt C, Rihs S et al. Consistent downregulation of the cleft lip/palate-associated genes IRF6 and GRHL3 in carcinomas Frontiers in oncology 2022-11-15 [PMID: 36457487] (IHC, Human)
• Eleftheria Girousi, Lukas Muerner, Ludovica Parisi, Silvia Rihs, Stephan von Gunten, Christos Katsaros, Martin Degen Lack of IRF6 Disrupts Human Epithelial Homeostasis by Altering Colony Morphology, Migration Pattern, and Differentiation Potential of Keratinocytes Frontiers in Cell and Developmental Biology 2021-09-30 [PMID: 34660580]

Bioinformatics

• Gene Symbol: IRF6