IRAK3 Antibody (1F6)

Images

 
Western Blot: IRAK3 Antibody (1F6) [H00011213-M02] - Analysis of IRAK3 expression in transfected 293T cell line by IRAK3 monoclonal antibody (M02), clone 1F6.Lane 1: IRAK3 transfected lysate(67.8 KDa).Lane 2: ...read more
Western Blot: IRAK3 Antibody (1F6) [H00011213-M02] - IRAK3 monoclonal antibody (M02), clone 1F6 Western Blot analysis of IRAK3 expression in HeLa ( Cat # L013V1 ).
Western Blot: IRAK3 Antibody (1F6) [H00011213-M02] - Analysis of IRAK3 over-expressed 293 cell line, cotransfected with IRAK3 Validated Chimera RNAi ( Cat # H00011213-R01V ) (Lane 2) or non-transfected control (Lane 1). ...read more
Sandwich ELISA: IRAK3 Antibody (1F6) [H00011213-M02] - Detection limit for recombinant GST tagged IRAK3 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IRAK3 Antibody (1F6) Summary

Immunogen
IRAK3 (AAH57800, 497 a.a. ~ 596 a.a) partial recombinant protein with GST tag.RIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSS CEESWFPKYIVPSQDLRPYKVNIDPSSEAPGHSCRSRPVESS CSSKFSWDEYEQYKKE
Localization
Cell membrane
Specificity
IRAK3 - interleukin-1 receptor-associated kinase 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IRAK3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IRAK3 Antibody (1F6)

  • ASRT5
  • EC 2.7.11.1
  • FLJ13601
  • IL-1 receptor-associated kinase M
  • interleukin-1 receptor-associated kinase 3
  • IRAK3
  • IRAK-3
  • IRAKM
  • IRAK-M

Background

This protein is a novel member in the IRAK/Pelle family. IRAKs associate with IL-1/Toll receptors after IL-1 or LPS stimulation and play a central role in IL-1R/TLR mediated inflammatory responses. Interleukin-1 (IL-1) and lipopolysaccharide (LPS)induces cellular response through IL-1 receptor (IL-1R) and Toll like receptors (TLR). IL-1 receptor associated kinase (IRAK and IRAK2) mediates the activation of NF-kB by IL-1/Toll receptors (Wesche H et al.1999,Muzio M et al.1997), which is a pivotal transcription factor mediating inflammatory and immune response. A novel member in theIRAK/Pelle family was recently identified and designated IRAK-M (Cao Z et al.1996). IRAKs associate with IL-1/Toll receptors after IL-1 or LPS stimulation and thedominant negative mutants of IRAKs inhibit IL-1 orLPS induced NF-kB activation. Members inIRAK/Pelle family play a central role in IL-1R/TLRmediated inflammatory responses to cytokine IL-1and LPS.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB100-56699
Species: Hu, Mu, Rt
Applications: WB, IP
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NB500-597
Species: Hu, Mu, Rt
Applications: WB, Flow, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-26506
Species: Hu, Mu, Rt
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
NB100-56447
Species: Hu, Mu
Applications: WB
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
NB100-56637
Species: Hu, Mu
Applications: WB
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for IRAK3 Antibody (H00011213-M02) (0)

There are no publications for IRAK3 Antibody (H00011213-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRAK3 Antibody (H00011213-M02) (0)

There are no reviews for IRAK3 Antibody (H00011213-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IRAK3 Antibody (H00011213-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IRAK3 Products

Bioinformatics Tool for IRAK3 Antibody (H00011213-M02)

Discover related pathways, diseases and genes to IRAK3 Antibody (H00011213-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRAK3 Antibody (H00011213-M02)

Discover more about diseases related to IRAK3 Antibody (H00011213-M02).
 

Pathways for IRAK3 Antibody (H00011213-M02)

View related products by pathway.

PTMs for IRAK3 Antibody (H00011213-M02)

Learn more about PTMs related to IRAK3 Antibody (H00011213-M02).
 

Research Areas for IRAK3 Antibody (H00011213-M02)

Find related products by research area.

Blogs on IRAK3

There are no specific blogs for IRAK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IRAK3 Antibody (1F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol IRAK3
Entrez
OMIM
Uniprot