Integrin beta 5 Antibody

Images

 
Immunohistochemistry-Paraffin: Integrin beta 5 Antibody [NBP1-88117] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Integrin beta 5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KCHAGYIGDNCNCSTDISTCRGRDGQICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSLCRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGB5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Integrin beta 5 Protein (NBP1-88117PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Integrin beta 5 Antibody

  • FLJ26658
  • Integrin beta 5
  • integrin beta-5
  • integrin, beta 5
  • ITGB5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
BBA37
Species: Hu
Applications: AdBlk
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NBP2-27418
Species: Hu, Pm
Applications: WB
AF4076
Species: Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
AF385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
AF1219
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
NBP1-85747
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, IP
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF4259
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-88117
Species: Hu
Applications: IHC, IHC-P

Publications for Integrin beta 5 Antibody (NBP1-88117) (0)

There are no publications for Integrin beta 5 Antibody (NBP1-88117).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin beta 5 Antibody (NBP1-88117) (0)

There are no reviews for Integrin beta 5 Antibody (NBP1-88117). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Integrin beta 5 Antibody (NBP1-88117) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin beta 5 Products

Bioinformatics Tool for Integrin beta 5 Antibody (NBP1-88117)

Discover related pathways, diseases and genes to Integrin beta 5 Antibody (NBP1-88117). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin beta 5 Antibody (NBP1-88117)

Discover more about diseases related to Integrin beta 5 Antibody (NBP1-88117).
 

Pathways for Integrin beta 5 Antibody (NBP1-88117)

View related products by pathway.

PTMs for Integrin beta 5 Antibody (NBP1-88117)

Learn more about PTMs related to Integrin beta 5 Antibody (NBP1-88117).
 

Research Areas for Integrin beta 5 Antibody (NBP1-88117)

Find related products by research area.

Blogs on Integrin beta 5

There are no specific blogs for Integrin beta 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin beta 5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGB5
Entrez