Integrin alpha V/CD51 Antibody - BSA Free

Immunohistochemistry-Paraffin: Integrin alpha V/CD51 Antibody [NBP1-85746] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.

Simple Western: Integrin alpha V/CD51 Antibody [NBP1-85746] - Simple Western lane view shows a specific band for ITGAV in 0.2 mg/ml of RT4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: Integrin alpha V/CD51 Antibody [NBP1-85746] - Electropherogram image of the corresponding Simple Western lane view. ITGAV antibody was used at 1:25 dilution on RT4 lysate(s) respectively.

Staining of human cell line A-431 shows localization to cytosol & focal adhesion sites.

• Reactivity: Hu, Rt
• Applications: Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Integrin alpha V/CD51 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWG
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITGAV
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:25
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 lysate, separated by Size, antibody dilution of 1:25, apparent MW was 173 kDa.
• Control Peptide:

  Integrin alpha V/CD51 Protein (NBP1-85746PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Integrin alpha V/CD51 Antibody - BSA Free

• antigen identified by monoclonal L230
• CD51 antigen
• CD51
• Integrin alpha V
• integrin alpha-V
• integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51)
• ITGAV
• MSK8
• Vitronectin Receptor alpha
• Vitronectin receptor subunit alpha
• VNRA
• VNRADKFZp686A08142

Background

Integrin alpha V chain interacts with the integrin beta 3 subunit/CD61 to form the alpha-V-beta-3 heterodimer/vitronectin receptor. It is expressed on endothelial cells, some activated leukocytes, NK cells, macrophages, neutrophils, and platelets. Integrin alpha V also forms heterodimers with the integrin beta 1, beta 5, beta 6, and beta 8 subunits. Alpha-V-beta-3 is an activation dependent receptor for platelet attachment and spreading on vitronectin and other matrix components.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Integrin alpha V/CD51 Antibody (NBP1-85746)(1)

Publication using NBP1-85746

• Stueven NA, Beauvais DM, Hu R et al. Inhibiting IGF1R-mediated Survival Signaling in Head and Neck Cancer with the Peptidomimetic SSTN(IGF1R) Cancer Research Communications 2023-01-19 [PMID: 36968227] (In vivo assay)

Bioinformatics

• Gene Symbol: ITGAV