Integrin alpha V/CD51 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Integrin alpha V/CD51 Antibody [NBP1-85746] - Staining of human cell line A-431 shows localization to cytosol & focal adhesion sites. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Integrin alpha V/CD51 Antibody [NBP1-85746] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.
Simple Western: Integrin alpha V/CD51 Antibody [NBP1-85746] - Simple Western lane view shows a specific band for ITGAV in 0.2 mg/ml of RT4 lysate(s). This experiment was performed under reducing conditions using the ...read more
Simple Western: Integrin alpha V/CD51 Antibody [NBP1-85746] - Electropherogram image of the corresponding Simple Western lane view. ITGAV antibody was used at 1:25 dilution on RT4 lysate(s) respectively.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Integrin alpha V/CD51 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGAV
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Simple Western 1:25
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size.
Control Peptide
Integrin alpha V/CD51 Protein (NBP1-85746PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Integrin alpha V/CD51 Antibody

  • antigen identified by monoclonal L230
  • CD51 antigen
  • CD51
  • Integrin alpha V
  • integrin alpha-V
  • integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51)
  • ITGAV
  • MSK8
  • Vitronectin Receptor alpha
  • Vitronectin receptor subunit alpha
  • VNRA
  • VNRADKFZp686A08142

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20866
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
796-IC
Species: Mu
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC

Publications for Integrin alpha V/CD51 Antibody (NBP1-85746) (0)

There are no publications for Integrin alpha V/CD51 Antibody (NBP1-85746).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha V/CD51 Antibody (NBP1-85746) (0)

There are no reviews for Integrin alpha V/CD51 Antibody (NBP1-85746). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Integrin alpha V/CD51 Antibody (NBP1-85746) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha V/CD51 Products

Bioinformatics Tool for Integrin alpha V/CD51 Antibody (NBP1-85746)

Discover related pathways, diseases and genes to Integrin alpha V/CD51 Antibody (NBP1-85746). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha V/CD51 Antibody (NBP1-85746)

Discover more about diseases related to Integrin alpha V/CD51 Antibody (NBP1-85746).
 

Pathways for Integrin alpha V/CD51 Antibody (NBP1-85746)

View related products by pathway.

PTMs for Integrin alpha V/CD51 Antibody (NBP1-85746)

Learn more about PTMs related to Integrin alpha V/CD51 Antibody (NBP1-85746).
 

Research Areas for Integrin alpha V/CD51 Antibody (NBP1-85746)

Find related products by research area.

Blogs on Integrin alpha V/CD51

There are no specific blogs for Integrin alpha V/CD51, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha V/CD51 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGAV
Entrez