Recombinant Human Integrin alpha 8 Protein

Images

 
SDS-Page: Recombinant Human Integrin alpha 8 Protein [H00008516-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Integrin alpha 8 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 836-935 of Human Integrin alpha 8

Source: Wheat Germ

Amino Acid Sequence: SDTILEVGWPFSARDEFLLYIFHIQTLGPLQCQPNPNINPQDIKPAASPEDTPELSAFLRNSTIPHLVRKRDVHVVEFHRQSPAKILNCTNIECLQISCA

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ITGA8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Integrin alpha 8 Protein

  • Integrin alpha 8
  • integrin alpha-8
  • integrin, alpha 8
  • ITGA8

Background

ITGA8 - integrin, alpha 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-193
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, IA, IHC, IHC-Fr, IHC-P, IP
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-2080
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP, MiAr, Single Cell Western
NBP2-27418
Species: Hu, Pm
Applications: WB
AF8035
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
MAB1354
Species: Hu
Applications: Flow, CyTOF-ready, ICC
AF385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
AF1062
Species: Mu
Applications: WB, IHC, Neut
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-91258
Species: Hu, Mu, Bv, Ca, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF591
Species: Mu
Applications: Flow, IHC, CyTOF-ready
AF-241-NA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Integrin alpha 8 Partial Recombinant Protein (H00008516-Q01) (0)

There are no publications for Integrin alpha 8 Partial Recombinant Protein (H00008516-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 8 Partial Recombinant Protein (H00008516-Q01) (0)

There are no reviews for Integrin alpha 8 Partial Recombinant Protein (H00008516-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin alpha 8 Partial Recombinant Protein (H00008516-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Integrin alpha 8 Partial Recombinant Protein (H00008516-Q01)

Discover related pathways, diseases and genes to Integrin alpha 8 Partial Recombinant Protein (H00008516-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 8 Partial Recombinant Protein (H00008516-Q01)

Discover more about diseases related to Integrin alpha 8 Partial Recombinant Protein (H00008516-Q01).
 

Pathways for Integrin alpha 8 Partial Recombinant Protein (H00008516-Q01)

View related products by pathway.

PTMs for Integrin alpha 8 Partial Recombinant Protein (H00008516-Q01)

Learn more about PTMs related to Integrin alpha 8 Partial Recombinant Protein (H00008516-Q01).

Blogs on Integrin alpha 8

There are no specific blogs for Integrin alpha 8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Integrin alpha 8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA8
Entrez