Home » Integrin alpha 2b/CD41 » Integrin alpha 2b/CD41 Antibodies » Integrin alpha 2b/CD41 Antibody

Integrin alpha 2b/CD41 Antibody

 
 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Analysis in human bone marrow and colon tissues. Corresponding Integrin alpha 2b/CD41 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Analysis in human bone marrow and colon tissues. Corresponding Integrin alpha 2b/CD41 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Staining of human bone marrow, colon, liver and lymph node using Anti-ITGA2B antibody NBP1-84581 (A) shows ...read more
Western Blot: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line HEL
Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.
Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Staining of human colon shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Staining of human liver shows no positivity in hepatocytes as expected.
Simple Western: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Simple Western lane view shows a specific band for Integrin alpha 2b/CD41 in 0.2 mg/ml of HEL lysate(s). This experiment was performed under reducing ...read more
Simple Western: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Electropherogram image of the corresponding Simple Western lane view. Integrin alpha 2b/CD41 antibody was used at 1:25 dilution on HEL lysate(s) ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Integrin alpha 2b/CD41 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGA2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Simple Western 1:25
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
Control Peptide
Integrin alpha 2b/CD41 Protein (NBP1-84581PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Integrin alpha 2b/CD41 Antibody

  • CD41 antigen
  • CD41
  • CD41BHPA3
  • GP2B
  • GP2Bintegrin alpha-IIb
  • GPalpha IIb
  • GPIIb
  • GTA
  • HPA3
  • Integrin alpha 2b
  • integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41)
  • integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41B)
  • ITGA2b
  • ITGAB
  • platelet fibrinogen receptor, alpha subunit
  • Platelet membrane glycoprotein IIb
  • platelet-specific antigen BAK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

P-Selectin/CD62P
137-PS
P-Selectin/CD62P
(4 Reviews)
(38 Publications)
Species: Hu
Applications: BA
Integrin beta
3/CD61 Antibody (SJ19
NBP2-67416
Immunocytochemistry/Immunofluorescence: Integrin beta 3/CD61 Antibody (SJ19-09) [NBP2-67416] - Staining Integrin beta 3 in HeLa cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X-100/PBS.
Immunocytochemistry/Immunofluorescence: Integrin beta 3/CD61 Antibody (SJ19-09) [NBP2-67416] - Staining Integrin beta 3 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X-100/PBS.
Immunohistochemistry-Paraffin: Integrin beta 3/CD61 Antibody (SJ19-09) [NBP2-67416] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-Integrin beta 3 antibody. Counter stained with hematoxylin.
(2 Reviews)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Tenascin C
Antibody (4C8MS) - BS
NB110-68136
Flow Cytometry: Tenascin C Antibody (4C8MS) [NB110-68136] - An intracellular stain was performed on SK-MEL-28 cells with Tenascin C Antibody (4C8MS) NB110-68136 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody (F0101B, R&D Systems).
Immunocytochemistry/Immunofluorescence: Tenascin C Antibody (4C8MS) [NB110-68136] - SK-MEL-28 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-Tenascin C at 5 ug/ml overnight at 4C and detected with an anti-Mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: Tenascin C Antibody (4C8MS) [NB110-68136] - An intracellular stain was performed on SK-MEL-28 cells with Tenascin C Antibody (4C8MS) NB110-68136AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
(2 Reviews)
(24 Publications)
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
RNF130 Antibody
NBP1-81858
Immunohistochemistry-Paraffin: RNF130 Antibody [NBP1-81858] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Western Blot: RNF130 Antibody [NBP1-81858] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-478
Species: Hu
Applications: IHC, IHC-P, WB
Von Willebrand
Factor Antibody
NB600-586
Dual RNAscope ISH-IHC: Von Willebrand Factor Antibody [NB600-586] - Formalin-fixed paraffin-embedded tissue sections of human metastatic tonsil were probed for vWF mRNA (ACD RNAScope probe, catalog # 5860461; Fast Red chromogen, ACD catalog # 322500). Adjacent tissue section was processed for immunohistochemistry using rabbit polyclonal (Novus catalog # NB600-586) at 1:500 dilution for 1 hour at room temperature followed by incubation with the anti-rabbit IgG VisUCyte HRP Polymer Antibody (Catalog # VC003) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue).
Immunohistochemistry-Frozen: Von Willebrand Factor Antibody [NB600-586] - Canine brain/spinal cord. VWF antibody in green. A pericyte marker in red. Alexa Fluor conjugated secondary antibodies were used for visualization. IHC-Fr image submitted by a verified customer review.
Immunohistochemistry: Von Willebrand Factor Antibody [NB600-586] - Formalin fixed paraffin embedded human tonsil stained with Factor VIII antibody.
(3 Reviews)
(6 Publications)
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(3 Publications)
Species: Hu
Applications: BA

Thrombopoietin/THPO [U
288-TPN/CF
Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 5-15 ng/mL.
(6 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Analysis of Protein Array containing more than 19,000 full-length human proteins using HLA DQ/DR/DP Antibody (HLA-Pan/2967R). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.
Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).
Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(23 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CD34 Antibody (MEC
14.7)
NB600-1071
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - An intracellular stain was performed on Raw264.7 cells with CD34 Antibody [MEC 14.7] NB600-1071 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rat IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 488 (SA5-10018, Thermo Fisher).
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 (MEC 14.7) antibody was tested at 1:250 in WEHI-3 cells with DyLight 488 (green) alongside a matched isotype control (black).
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(24 Publications)
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HO-1/HMOX1/HSP32
Antibody (HO-1-1)
NBP1-97507
Flow Cytometry: HO-1/HMOX1/HSP32 Antibody (HO-1-1) [NBP1-97507] - Analysis of 10^6 Jurkat cells stained using HO-1 monoclonal antibody (HO-1-1), (Prod. No. ADI-OSA-110), at a concentration of 50 ug/mL
Immunohistochemistry-Paraffin: HO-1/HMOX1/HSP32 Antibody (HO-1-1) [NBP1-97507] - Analysis of human spleen tissue stained with HO-1, mAb (HO-1-1) at 10ug/ml.
Western Blot: HO-1/HMOX1/HSP32 Antibody (HO-1-1) [NBP1-97507] - Lane 1: MW marker; Lane 2: HO-1 (rat), (recombinant); Lane 3: HO-1 (human), (recombinant); Lane 4: HO-2 (human), (recombinant); Lane 5: MDBK cell lysate; Lane 6: Dog liver microsome; Lane 7: Mouse liver microsome.
(1 Review)
(16 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
GLS2 Antibody -
BSA Free
NBP1-76544
Western Blot: GLS2 Antibody [NBP1-76544] - Glutaminase protein expression in PC3 and PC3M cell lines before/after CB-839 treatment. PC3 & PC3M cells were treated (+) or not treated (-) with GLS1 inhibitor CB-839 (1 uM) and their expression of GLS1 & GLS2 proteins determined by Western blot. Antibodies specific for GAC & KCA were utilized on two replicate samples, while GLS2 expression was determined on three. PC3 cell lysates expressed GLS2 more than PC3M cell lysates regardless of CB-839 treatment. The difference in GLS2 expression was significant in the untreated cells (P?<?0.03) but because of high variability the difference was not significant in the drug-treated cells. Levels of GLS1 (GAC and KGA) were similar in all cell lysates. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-017-16327-z), licensed under a CC-BY licence.
Immunohistochemistry: GLS2 Antibody [NBP1-76544] - Immunohistochemistry of GLS2 in human kidney tissue with GLS2 antibody at 5 ug/mL.
Immunocytochemistry/Immunofluorescence: GLS2 Antibody [NBP1-76544] - of GLS2 in Human Kidney cells. Dilution 20 ug/mL.
(5 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
AGA Antibody
NBP1-88866
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining in human epididymis and skeletal muscle tissues using anti-AGA antibody. Corresponding AGA RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
IL-6 [HRP]
D6050
(32 Reviews)
(643 Publications)
Species: Hu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(719 Publications)
Species: Hu
Applications: BA
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(15 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DUSP2 Antibody
NBP2-92318
Western Blot: DUSP2 Antibody [NBP2-92318] - Analysis of extracts of various cell lines, using DUSP2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.
Species: Hu, Mu, Rt
Applications: WB
ASAH1 Antibody
NBP1-89296
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human kidney shows strong granular cytoplasmic positivity in a subset of renal tubules.
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
(6 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
eNOS Antibody -
BSA Free
NB300-500
Immunohistochemistry: eNOS Antibody [NB300-500] - Staining of representative pulmonary artery endothelial cells from rats subjected to CON=Control Group, ALI=Acute lung injury Group, LV=Low tidal volume Group, VLV=Very low tidal volume Group, MV=Large tidal volume Group. Dark brown staining of indicates eNOS-positive cells. Magnification x400.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Expression of endothelial markers indicate functional endothelium in TEVG. Whole mount staining of native aorta and TEVG. VE-cadherin is a marker of cellular borders of endothelial cells (green). Endothelial nitric oxide synthase (eNOS) is a marker of a functional endothelium (red). DAPI is a nuclear stain (blue). Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0120328), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Staining of eNOS in human lung tissue.
(3 Reviews)
(20 Publications)
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Integrin alpha
2b/CD41 Antibody
NBP1-84581
Integrin alpha 2b/CD41 Antibody
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P

Publications for Integrin alpha 2b/CD41 Antibody (NBP1-84581) (0)

There are no publications for Integrin alpha 2b/CD41 Antibody (NBP1-84581).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 2b/CD41 Antibody (NBP1-84581) (0)

There are no reviews for Integrin alpha 2b/CD41 Antibody (NBP1-84581). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin alpha 2b/CD41 Antibody (NBP1-84581) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha 2b/CD41 Products

Bioinformatics Tool for Integrin alpha 2b/CD41 Antibody (NBP1-84581)

Discover related pathways, diseases and genes to Integrin alpha 2b/CD41 Antibody (NBP1-84581). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 2b/CD41 Antibody (NBP1-84581)

Discover more about diseases related to Integrin alpha 2b/CD41 Antibody (NBP1-84581).
 

Pathways for Integrin alpha 2b/CD41 Antibody (NBP1-84581)

View related products by pathway.

PTMs for Integrin alpha 2b/CD41 Antibody (NBP1-84581)

Learn more about PTMs related to Integrin alpha 2b/CD41 Antibody (NBP1-84581).
 

Research Areas for Integrin alpha 2b/CD41 Antibody (NBP1-84581)

Find related products by research area.

Blogs on Integrin alpha 2b/CD41

There are no specific blogs for Integrin alpha 2b/CD41, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 2b/CD41 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ITGA2B