Home » Integrin alpha 2b/CD41 » Integrin alpha 2b/CD41 Antibodies » Integrin alpha 2b/CD41 Antibody

Integrin alpha 2b/CD41 Antibody

 
 Submit a Review

Images

 
(
Enlarge)
Western Blot: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line HEL
Western Blot: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line HEL
Orthogonal Strategies: Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Staining in human bone marrow and stomach tissues using anti-ITGA2B antibody. Corresponding ITGA2B RNA-seq data ...read more
Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Staining of human stomach shows low expression as expected.
Simple Western: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Simple Western lane view shows a specific band for Integrin alpha 2b/CD41 in 0.2 mg/ml of HEL lysate(s). This experiment was performed under reducing ...read more
Simple Western: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Electropherogram image of the corresponding Simple Western lane view. Integrin alpha 2b/CD41 antibody was used at 1:25 dilution on HEL lysate(s) ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Integrin alpha 2b/CD41 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAV
Specificity
Specificity of human Integrin alpha 2b/CD41 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGA2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Simple Western 1:25
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
Control Peptide
Integrin alpha 2b/CD41 Protein (NBP1-84581PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Integrin alpha 2b/CD41 Antibody

  • CD41 antigen
  • CD41
  • CD41BHPA3
  • GP2B
  • GP2Bintegrin alpha-IIb
  • GPalpha IIb
  • GPIIb
  • GTA
  • HPA3
  • Integrin alpha 2b
  • integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41)
  • integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41B)
  • ITGA2b
  • ITGAB
  • platelet fibrinogen receptor, alpha subunit
  • Platelet membrane glycoprotein IIb
  • platelet-specific antigen BAK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

P-Selectin/CD62P
137-PS
P-Selectin/CD62P
(3 Reviews)
(27 Publications)
Species: Hu
Integrin beta
3/CD61 Antibody (BV4)
NB600-1342
Integrin beta 3/CD61 Antibody (BV4)
(6 Publications)
Species: Hu, Mu, Rt, Bv
Applications: WB, IA, IHC, IHC-Fr, IHC-P, IP
Tenascin C
Antibody (4C8MS)
NB110-68136
Flow (Intracellular): Tenascin C Antibody (4C8MS) [NB110-68136] - Figure A: An intracellular stain was performed on U87MG Cells with Tenascin C (4C8MS) antibody NB110-68136 (blue) and a matched isotype control NBP1-97005 (orange). Cells were fixed with 4% paraformaldehyde, following fixation, cells were permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody [F0101B, R&D Systems].Figure B: U87MG Cells were either untreated (orange) or treated with 3uM Monensin (blue). An intracellular stain was performed with Tenascin C (4C8MS) antibody NB110-68136. Cells were fixed with 4% paraformaldehyde, following fixation, cells were permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody [F0101B, R&D Systems].
Immunohistochemistry-Paraffin: Tenascin C Antibody (4C8MS) [NB110-68136] - IHC analysis of a formalin fixed paraffin embedded tissue section of mouse bone-tendon using Tenascin C antibody (clone 4C8MS) at 1:25 dilution. The signal was detected using HRP-DAB detection method which followed counterstaining using hematoxylin. The antibody generated a very specific cytoplasmic, membrane and extra-cellular signal in tendon fibroblasts, osteoblasts, osteoclasts, and some bone marrow cells. The mineralized areas were largely negative for the staining.
Flow Cytometry: Tenascin C Antibody (4C8MS) [NB110-68136] - An intracellular stain was performed on SK-MEL-28 cells with Tenascin C Antibody (4C8MS) NB110-68136 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody (F0101B, R&D Systems).
(1 Review)
(18 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
RNF130 Antibody
NBP1-81858
Western Blot: RNF130 Antibody [NBP1-81858] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-478
Immunohistochemistry-Paraffin: RNF130 Antibody [NBP1-81858] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: WB, IHC, IHC-P
Von Willebrand
Factor Antibody
NB600-586
Immunocytochemistry/Immunofluorescence: Von Willebrand Factor Antibody [NB600-586]
Immunohistochemistry-Paraffin: Von Willebrand Factor Antibody [NB600-586] - Staining of formalin-fixed, paraffin-embedded Human Kidney sections with 1:2,000 Rabbit Anti-von Willebrand Factor.
Immunohistochemistry: Von Willebrand Factor Antibody [NB600-586] - Formalin fixed paraffin embedded human tonsil stained with Factor VIII antibody.
(2 Reviews)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CTLA-4 Antibody
[Unconjugated]
AF-386-PB
Western blot shows lysates of NS0 mouse myeloma cell line either mock transfected or transfected with human CTLA-4. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human CTLA‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-386-PB) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for CTLA‑4 at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
NS0 mouse myeloma cell line co-transfected with human CTLA-4 and eGFP was stained with either (A) Goat Anti-Human CTLA‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-386-PB) or (B) Normal Goat IgG Control (Catalog # AB-108-C) followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
CTLA‑4 was detected in immersion fixed human peripheral blood mononuclear cells treated with treated with PMA and calcium ionomycin using Goat Anti-Human CTLA‑4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-386-PB) at 15 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(2 Reviews)
(2 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Thrombopoietin/Tpo
288-TP/CF
1 µg/lane of Recombinant Human Thrombopoietin was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing major bands at 43-60 kDa.
Recombinant Human Thrombopoietin/Tpo (Catalog # 288-TP/CF) stimulates pro­liferation in the MO7e human megakaryocytic leukemic cell line. The ED50 for this effect is 0.3-3 ng/mL.
(50 Publications)
Species: Hu
HLA DQA1 Antibody
NBP1-84550
Western Blot: HLA DQA1 Antibody [NBP1-84550] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line Daudi.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human lung shows high expression.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Species: Hu
Applications: WB, IHC, IHC-P
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
CD34 Antibody (MEC
14.7)
NB600-1071
Immunocytochemistry/Immunofluorescence: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 antibody was tested in WEHI-3 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry-Paraffin: CD34 Antibody (MEC 14.7) [NB600-1071] - IHC analysis of a formalin fixed and paraffin embedded tissue section of mouse small intestine using rat anti-mouse CD34 (clone MEC 14.7) at 1:100 dilution. The signal was developed using HRP-conjugated anti-rat secondary with DAB reagent which followed counterstaining of nuclei using hematoxylin. This antibody specifically labelled the endothelial cells in blood vessels located primarily in the sub-mucosa, and of that of the mucosa muscularis and the mucosal lacteal.
Flow Cytometry: CD34 Antibody (MEC 14.7) [NB600-1071] - CD34 (MEC 14.7) antibody was tested at 1:250 in WEHI-3 cells with DyLight 488 (green) alongside a matched isotype control (black).
(17 Publications)
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
HO-1/HMOX1/HSP32
Antibody (HO-1-1)
NBP1-97507
Western Blot: HO-1/HMOX1/HSP32 Antibody (HO-1-1) [NBP1-97507] - Lane 1: MW marker; Lane 2: HO-1 (rat), (recombinant); Lane 3: HO-1 (human), (recombinant); Lane 4: HO-2 (human), (recombinant); Lane 5: MDBK cell lysate; Lane 6: Dog liver microsome; Lane 7: Mouse liver microsome.
Immunohistochemistry-Paraffin: HO-1/HMOX1/HSP32 Antibody (HO-1-1) [NBP1-97507] - Analysis of human spleen tissue stained with HO-1, mAb (HO-1-1) at 10ug/ml.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
GLS2 Antibody
NBP1-76544
Immunocytochemistry/Immunofluorescence: GLS2 Antibody [NBP1-76544] - of GLS2 in Human Kidney cells. Dilution 20 ug/mL.
Immunohistochemistry: GLS2 Antibody [NBP1-76544] - Immunohistochemistry of GLS2 in human kidney tissue with GLS2 antibody at 5 ug/mL.
Simple Western: GLS2 Antibody [NBP1-76544] - Simple Western lane view shows a specific band for GLS2 in 0.5 mg/ml of Hek293 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
AGA Antibody
NBP1-88866
Immunocytochemistry/Immunofluorescence: AGA Antibody [NBP1-88866] - Staining of human cell line U-2 OS shows positivity in vesicles and cytoskeleton (microtubules).
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: AGA Antibody [NBP1-88866] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(492 Publications)
Species: Hu
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(4 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
DUSP2 Antibody
NBP2-14934
Western Blot: DUSP2 Antibody [NBP2-14934] - analysis of DUSP2 in HeLa cell lysate using anti-DUSP2 antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: DUSP2 Antibody [NBP2-14934] - Paraformaldehyde-fixed HeLa, using DUSP2/PAC1 antibody at 1:1000 dilution.
Immunohistochemistry-Paraffin: DUSP2 Antibody [NBP2-14934] - Paraffin-embedded Oral CA, using antibody at 1:100 dilution.
(1 Review)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ASAH1 Antibody
NBP1-89296
Western Blot: ASAH1 Antibody [NBP1-89296] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-ASAH1 antibody. Corresponding ASAH1 RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
(5 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
eNOS Antibody
NB300-500
Immunohistochemistry: eNOS Antibody [NB300-500] - The pulmonary tissues were analyzed for expression of eNOS protein by immunohistochemistry(IHC). Dark brown staining of indicates eNOS-positive cells. IHC stain of representative pulmonary artery endothelial cells from rats subjected to CON=Control Group, ALI=Acute lung injury Group, LV=Low tidal volume Group, VLV=Very low tidal volume Group, MV=Large tidal volume Group (magnification, x400).
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Staining of eNOS in human lung tissue.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Mouse Carotid Artery stained with eNOS antibody. Image from verified customer review.
(3 Reviews)
(10 Publications)
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for Integrin alpha 2b/CD41 Antibody (NBP1-84581) (0)

There are no publications for Integrin alpha 2b/CD41 Antibody (NBP1-84581).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 2b/CD41 Antibody (NBP1-84581) (0)

There are no reviews for Integrin alpha 2b/CD41 Antibody (NBP1-84581). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin alpha 2b/CD41 Antibody (NBP1-84581) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha 2b/CD41 Products

Bioinformatics Tool for Integrin alpha 2b/CD41 Antibody (NBP1-84581)

Discover related pathways, diseases and genes to Integrin alpha 2b/CD41 Antibody (NBP1-84581). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 2b/CD41 Antibody (NBP1-84581)

Discover more about diseases related to Integrin alpha 2b/CD41 Antibody (NBP1-84581).
 

Pathways for Integrin alpha 2b/CD41 Antibody (NBP1-84581)

View related products by pathway.

PTMs for Integrin alpha 2b/CD41 Antibody (NBP1-84581)

Learn more about PTMs related to Integrin alpha 2b/CD41 Antibody (NBP1-84581).

Blogs on Integrin alpha 2b/CD41

There are no specific blogs for Integrin alpha 2b/CD41, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 2b/CD41 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ITGA2B
Entrez