Integrin alpha 2b/CD41 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Analysis in human bone marrow and colon tissues. Corresponding Integrin alpha 2b/CD41 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Staining of human bone marrow, colon, liver and lymph node using Anti-ITGA2B antibody NBP1-84581 (A) shows ...read more
Western Blot: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line HEL
Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.
Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.
Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Staining of human colon shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Staining of human liver shows no positivity in hepatocytes as expected.
Simple Western: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Simple Western lane view shows a specific band for Integrin alpha 2b/CD41 in 0.2 mg/ml of HEL lysate(s). This experiment was performed under reducing ...read more
Simple Western: Integrin alpha 2b/CD41 Antibody [NBP1-84581] - Electropherogram image of the corresponding Simple Western lane view. Integrin alpha 2b/CD41 antibody was used at 1:25 dilution on HEL lysate(s) ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Integrin alpha 2b/CD41 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGA2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Simple Western 1:25
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
Control Peptide
Integrin alpha 2b/CD41 Protein (NBP1-84581PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Integrin alpha 2b/CD41 Antibody

  • CD41 antigen
  • CD41
  • CD41BHPA3
  • GP2B
  • GP2Bintegrin alpha-IIb
  • GPalpha IIb
  • GPIIb
  • GTA
  • HPA3
  • Integrin alpha 2b
  • integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41)
  • integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41B)
  • ITGA2b
  • ITGAB
  • platelet fibrinogen receptor, alpha subunit
  • Platelet membrane glycoprotein IIb
  • platelet-specific antigen BAK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

137-PS
Species: Hu
Applications: BA
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-81858
Species: Hu
Applications: IHC, IHC-P, WB
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
7268-CT
Species: Hu
Applications: BA
288-TPN/CF
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-88866
Species: Hu
Applications: IHC, IHC-P
D6050
Species: Hu
Applications: ELISA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-92318
Species: Hu, Mu, Rt
Applications: WB
NBP1-89296
Species: Hu
Applications: IHC, IHC-P, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
NBP1-84581
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P

Publications for Integrin alpha 2b/CD41 Antibody (NBP1-84581) (0)

There are no publications for Integrin alpha 2b/CD41 Antibody (NBP1-84581).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 2b/CD41 Antibody (NBP1-84581) (0)

There are no reviews for Integrin alpha 2b/CD41 Antibody (NBP1-84581). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Integrin alpha 2b/CD41 Antibody (NBP1-84581) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha 2b/CD41 Products

Bioinformatics Tool for Integrin alpha 2b/CD41 Antibody (NBP1-84581)

Discover related pathways, diseases and genes to Integrin alpha 2b/CD41 Antibody (NBP1-84581). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 2b/CD41 Antibody (NBP1-84581)

Discover more about diseases related to Integrin alpha 2b/CD41 Antibody (NBP1-84581).
 

Pathways for Integrin alpha 2b/CD41 Antibody (NBP1-84581)

View related products by pathway.

PTMs for Integrin alpha 2b/CD41 Antibody (NBP1-84581)

Learn more about PTMs related to Integrin alpha 2b/CD41 Antibody (NBP1-84581).
 

Research Areas for Integrin alpha 2b/CD41 Antibody (NBP1-84581)

Find related products by research area.

Blogs on Integrin alpha 2b/CD41

There are no specific blogs for Integrin alpha 2b/CD41, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 2b/CD41 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA2B