Integrin alpha 2b/CD41 Antibody

Images

 
Immunohistochemistry-Paraffin: Integrin alpha 2b/CD41 Antibody [NBP1-84580] - Staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Integrin alpha 2b/CD41 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITGA2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Integrin alpha 2b/CD41 Protein (NBP1-84580PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Integrin alpha 2b/CD41 Antibody

  • CD41 antigen
  • CD41
  • CD41BHPA3
  • GP2B
  • GP2Bintegrin alpha-IIb
  • GPalpha IIb
  • GPIIb
  • GTA
  • HPA3
  • Integrin alpha 2b
  • integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41)
  • integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigenCD41B)
  • ITGA2b
  • ITGAB
  • platelet fibrinogen receptor, alpha subunit
  • Platelet membrane glycoprotein IIb
  • platelet-specific antigen BAK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-81858
Species: Hu
Applications: WB, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-14934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-84580
Species: Hu
Applications: IHC, IHC-P

Publications for Integrin alpha 2b/CD41 Antibody (NBP1-84580) (0)

There are no publications for Integrin alpha 2b/CD41 Antibody (NBP1-84580).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin alpha 2b/CD41 Antibody (NBP1-84580) (0)

There are no reviews for Integrin alpha 2b/CD41 Antibody (NBP1-84580). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Integrin alpha 2b/CD41 Antibody (NBP1-84580) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Integrin alpha 2b/CD41 Products

Bioinformatics Tool for Integrin alpha 2b/CD41 Antibody (NBP1-84580)

Discover related pathways, diseases and genes to Integrin alpha 2b/CD41 Antibody (NBP1-84580). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin alpha 2b/CD41 Antibody (NBP1-84580)

Discover more about diseases related to Integrin alpha 2b/CD41 Antibody (NBP1-84580).
 

Pathways for Integrin alpha 2b/CD41 Antibody (NBP1-84580)

View related products by pathway.

PTMs for Integrin alpha 2b/CD41 Antibody (NBP1-84580)

Learn more about PTMs related to Integrin alpha 2b/CD41 Antibody (NBP1-84580).

Blogs on Integrin alpha 2b/CD41

There are no specific blogs for Integrin alpha 2b/CD41, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Integrin alpha 2b/CD41 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGA2B
Entrez