EMP2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: EMP2 Antibody [NBP1-86847] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human skin shows moderate to strong positivity in plasma membrane in keratinocytes.

Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human lung shows moderate to strong cytoplasmic positivity in pneumocytes.

Western Blot: EMP2 Antibody [NBP1-86847] - Analysis of EMP2 in NIH/3T3 transfectant using anti-EMP2 antibody (1:500 dilution). Image from verified customer review.

Analysis in control (vector only transfected HEK293T lysate) and EMP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Analysis in human cell line MCF-7.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EMP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EMP2 Antibody - BSA Free (NBP1-86847) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-EMP2 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EMP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.
• Control Peptide:

  EMP2 Protein (NBP1-86847PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EMP2 Antibody - BSA Free

• EMP2
• epithelial membrane protein 2
• MGC9056
• Protein XMP
• XMP
• XMPEMP-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EMP2 Antibody (NBP1-86847)(3)

Publications using NBP1-86847

• Li CF, Wu WJ, Wu WR et al. The cAMP responsive element binding protein 1 transactivates epithelial membrane protein 2, a potential tumor suppressor in the urinary bladder urothelial carcinoma. Oncotarget 2015-04-20 [PMID: 25940704] (IF/IHC, WB, Human)
• Knepper J, Schierhorn KL, Becher A et al. The Novel Human Influenza A(H7N9) Virus Is Naturally Adapted to Efficient Growth in Human Lung Tissue. mBio 2013-10-08 [PMID: 24105764]
• Chen YH, Wu LC, Wu WR et al. Loss of epithelial membrane protein-2 expression confers an independent prognosticator in nasopharyngeal carcinoma: a cohort study. BMJ Open 2012-04-01 [PMID: 22492389]

Review for EMP2 Antibody (NBP1-86847) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 01/26/2015

Summary

• Application: Western Blot
• Sample Tested: NIH3T3 transfectant
• Species: Human
• Lot: A75786

Bioinformatics

• Gene Symbol: EMP2