EMP2 Antibody

Images

 
Western Blot: EMP2 Antibody [NBP1-86847] - Analysis in human cell line MCF-7.
Immunocytochemistry/ Immunofluorescence: EMP2 Antibody [NBP1-86847] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human lung shows strong membranous positivity in pneumocytes.
Western Blot: EMP2 Antibody [NBP1-86847] - Analysis of EMP2 in NIH/3T3 transfectant using anti-EMP2 antibody (1:500 dilution). Image from verified customer review.
Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EMP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST
Specificity
Specificity of human, mouse EMP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EMP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EMP2 Protein (NBP1-86847PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-86847 in the following applications:

Publications
Read Publications using
NBP1-86847 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24105764)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EMP2 Antibody

  • EMP2
  • epithelial membrane protein 2
  • MGC9056
  • Protein XMP
  • XMP
  • XMPEMP-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008833-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP2-65351
Species: Hu
MAB4505
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-59438
Species: Hu
Applications: WB, ELISA, IHC
NBP1-80656
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-15012
Species: Hu
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB7288
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-20180
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for EMP2 Antibody (NBP1-86847)(3)

Review for EMP2 Antibody (NBP1-86847) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-86847:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot EMP2 NBP1-86847
Enlarge
reviewed by:
Anonymous
WB Human 01/26/2015
View

Summary

ApplicationWestern Blot
Sample TestedNIH3T3 transfectant
SpeciesHuman
LotA75786

Blocking

Blocking Details2% cold fish geletin in TBS buffer, room temperature for 1hour

Primary Anitbody

Dilution Ratio1:500 overnight at 4C in blocking buffer

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP
Secondary Manufacturer Cat#Cell Signaling, #7074

Details

Detection Notes1 min exposure gives band at correct MW.

Comments

CommentsThis antibody worked fine in my cells that have been transfected with full length EMP2.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EMP2 Antibody (NBP1-86847) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EMP2 Products

Bioinformatics Tool for EMP2 Antibody (NBP1-86847)

Discover related pathways, diseases and genes to EMP2 Antibody (NBP1-86847). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EMP2 Antibody (NBP1-86847)

Discover more about diseases related to EMP2 Antibody (NBP1-86847).
 

Pathways for EMP2 Antibody (NBP1-86847)

View related products by pathway.

PTMs for EMP2 Antibody (NBP1-86847)

Learn more about PTMs related to EMP2 Antibody (NBP1-86847).

Blogs on EMP2

There are no specific blogs for EMP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
01/26/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol EMP2
Entrez