EMP2 Antibody

Images

 
Western Blot: EMP2 Antibody [NBP1-86847] - Analysis in control (vector only transfected HEK293T lysate) and EMP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: EMP2 Antibody [NBP1-86847] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in glomeruli.
Western Blot: EMP2 Antibody [NBP1-86847] - Analysis of EMP2 in NIH/3T3 transfectant using anti-EMP2 antibody (1:500 dilution). Image from verified customer review.
Western Blot: EMP2 Antibody [NBP1-86847] - Analysis in human cell line MCF-7.
Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human skin shows moderate to strong positivity in plasma membrane in keratinocytes.
Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human lung shows moderate to strong cytoplasmic positivity in pneumocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EMP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EMP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100.
Control Peptide
EMP2 Protein (NBP1-86847PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-86847 in the following applications:

Publications
Read Publications using
NBP1-86847 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EMP2 Antibody

  • EMP2
  • epithelial membrane protein 2
  • MGC9056
  • Protein XMP
  • XMP
  • XMPEMP-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91705
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83107
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00008833-M01
Species: Hu
Applications: ELISA, Flow, IHC, IHC-P, S-ELISA, WB
AF4467
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-80913
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB
NBP3-24816
Species: Hu
Applications: ICC/IF
MAB4505
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-59438
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-80656
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-33527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBL1-15012
Species: Hu
Applications: WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP2-48480
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
AF7288
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-20180
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NB100-615
Species: Hu, Mu, Rt, Sh
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-89192
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
MAB25301
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB

Publications for EMP2 Antibody (NBP1-86847)(3)

Review for EMP2 Antibody (NBP1-86847) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-86847:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot EMP2 NBP1-86847
Enlarge
5
reviewed by:
Verified Customer
WB Human 01/26/2015
View

Summary

ApplicationWestern Blot
Sample TestedNIH3T3 transfectant
SpeciesHuman
LotA75786

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EMP2 Antibody (NBP1-86847) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
01/26/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol EMP2