EMP2 Antibody


Western Blot: EMP2 Antibody [NBP1-86847] - Analysis in human cell line MCF-7.
Immunocytochemistry/ Immunofluorescence: EMP2 Antibody [NBP1-86847] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human pancreas shows moderate to strong cytoplasmic positivity in exocrine glandular cells.
Western Blot: EMP2 Antibody [NBP1-86847] - Analysis of EMP2 in NIH/3T3 transfectant using anti-EMP2 antibody (1:500 dilution). Image from verified customer review.
Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.
Orthogonal Strategies: Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Immunohistochemistry analysis in human lung and pancreas tissues. Corresponding RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human lung shows moderate to strong cytoplasmic positivity in pneumocytes
Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-86847] - Staining of human skin shows moderate to strong positivity in plasma membrane in keratinocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

EMP2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST
Specificity of human EMP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EMP2 Protein (NBP1-86847PEP)
Reviewed Applications
Read 1 Review rated 5
NBP1-86847 in the following applications:

Read Publications using
NBP1-86847 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24105764)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for EMP2 Antibody

  • EMP2
  • epithelial membrane protein 2
  • MGC9056
  • Protein XMP
  • XMP
  • XMPEMP-2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for EMP2 Antibody (NBP1-86847)(3)

Review for EMP2 Antibody (NBP1-86847) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-86847:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot EMP2 NBP1-86847
reviewed by:
WB Human 01/26/2015


ApplicationWestern Blot
Sample TestedNIH3T3 transfectant


Blocking Details2% cold fish geletin in TBS buffer, room temperature for 1hour

Primary Anitbody

Dilution Ratio1:500 overnight at 4C in blocking buffer

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP
Secondary Manufacturer Cat#Cell Signaling, #7074


Detection Notes1 min exposure gives band at correct MW.


CommentsThis antibody worked fine in my cells that have been transfected with full length EMP2.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EMP2 Antibody (NBP1-86847) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for EMP2 Antibody (NBP1-86847)

Discover related pathways, diseases and genes to EMP2 Antibody (NBP1-86847). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EMP2 Antibody (NBP1-86847)

Discover more about diseases related to EMP2 Antibody (NBP1-86847).

Pathways for EMP2 Antibody (NBP1-86847)

View related products by pathway.

PTMs for EMP2 Antibody (NBP1-86847)

Learn more about PTMs related to EMP2 Antibody (NBP1-86847).

Blogs on EMP2

There are no specific blogs for EMP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: WB
Species: Human


Gene Symbol EMP2