Signal Peptide Peptidase Antibody

Images

 
Western Blot: Signal Peptide Peptidase Antibody [NBP1-92389] - Analysis in control (vector only transfected HEK293T lysate) and HM13 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in ...read more
Immunohistochemistry-Paraffin: Signal Peptide Peptidase Antibody [NBP1-92389] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Signal Peptide Peptidase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGC
Specificity
Specificity of human Signal Peptide Peptidase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HM13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Signal Peptide Peptidase Antibody

  • dJ324O17.1
  • EC 3.4.23.-
  • H13hIMP1
  • histocompatibility (minor) 13
  • IMP-1
  • IMP1MSTP086
  • Intramembrane protease 1
  • minor histocompatibility antigen 13
  • minor histocompatibility antigen H13
  • Presenilin-like protein 3
  • PSENL3
  • PSL3IMPAS
  • signal peptide peptidase beta
  • Signal peptide peptidase
  • SPPIMPAS-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38956
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74510
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
NBP1-87512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84339
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-55109
Species: Hu
Applications: ICC/IF
NBP2-35058
Species: Hu

Publications for Signal Peptide Peptidase Antibody (NBP1-92389) (0)

There are no publications for Signal Peptide Peptidase Antibody (NBP1-92389).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Signal Peptide Peptidase Antibody (NBP1-92389) (0)

There are no reviews for Signal Peptide Peptidase Antibody (NBP1-92389). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Signal Peptide Peptidase Antibody (NBP1-92389) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Signal Peptide Peptidase Products

Bioinformatics Tool for Signal Peptide Peptidase Antibody (NBP1-92389)

Discover related pathways, diseases and genes to Signal Peptide Peptidase Antibody (NBP1-92389). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Signal Peptide Peptidase Antibody (NBP1-92389)

Discover more about diseases related to Signal Peptide Peptidase Antibody (NBP1-92389).
 

Pathways for Signal Peptide Peptidase Antibody (NBP1-92389)

View related products by pathway.

Blogs on Signal Peptide Peptidase

There are no specific blogs for Signal Peptide Peptidase, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Signal Peptide Peptidase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HM13
COVID-19 update