IMP Dehydrogenase 2/IMPDH2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Staining of human cell line A-431 shows localization to cytosol & rods & rings.

Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Staining of human liver shows no cytoplasmic positivity in hepatocytes as expected.

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.

Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1, using Anti-IMPDH2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IMP Dehydrogenase 2/IMPDH2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKD
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IMPDH2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 24139804). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 56 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  IMP Dehydrogenase 2/IMPDH2 Recombinant Protein Antigen (NBP1-86177PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24139804).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IMP Dehydrogenase 2/IMPDH2 Antibody - BSA Free

• EC 1.1.1.205
• IMDH2
• IMP (inosine 5'-monophosphate) dehydrogenase 2
• IMP (inosine monophosphate) dehydrogenase 2
• IMP Dehydrogenase 2
• IMP Oxireductase 2
• IMPD 2
• IMPD2
• IMPD2IMP oxireductase 2
• IMPDH 2
• IMPDH2
• IMPDH-II
• inosine 5' phosphate dehydrogenase 2
• inosine monophosphate dehydrogenase type II
• inosine-5'-monophosphate dehydrogenase 2

Background

IMPDH2 encodes the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. The encoded protein catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. This gene is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)(4)

Publications using NBP1-86177

• Barfeld SJ, Fazli L, Persson M et al. Myc-dependent purine biosynthesis affects nucleolar stress and therapy response in prostate cancer. Oncotarget 2015-05-20 [PMID: 25869206] (WB, Human)
• Wawrzyniak JA, Bianchi-Smiraglia A, Bshara W et al. A Purine Nucleotide Biosynthesis Enzyme Guanosine Monophosphate Reductase is a Suppressor of Melanoma Invasion. Cell Rep 2013-10-31 [PMID: 24139804] (IF/IHC, Human)
• Floryk D, Thompson TC et al. Antiproliferative effects of AVN944, a novel inosine 5-monophosphate dehydrogenase inhibitor, in prostate cancer cells. Int J Cancer 2008-11-01 [PMID: 18712736]
• Mannava S, Grachtchouk V, Wheeler LJ et al. Direct role of nucleotide metabolism in C-MYC-dependent proliferation of melanoma cells. Cell Cycle 2008-06-03 [PMID: 18677108]

Bioinformatics

• Gene Symbol: IMPDH2
• Entrez:
  • 3615(Human)
• Uniprot:
  • P12268()