Dihydrofolate Reductase/DHFR Antibody (2B10)

Images

 
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Folic acid treatment restores endothelial specific DHFR expression and activity in Ang II-infused apoE null mice.DHFR expression (A, n?=?8-11) ...read more
Immunocytochemistry/ Immunofluorescence: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Analysis of monoclonal antibody to DHFR on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - DHFR monoclonal antibody (M01), clone 2B10 Analysis of DHFR expression in HeLa.
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - DHFR monoclonal antibody (M01), clone 2B10. Analysis of DHFR expression in PC-12.
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Analysis of DHFR expression in transfected 293T cell line by DHFR monoclonal antibody (M01), clone 2B10.Lane 1: DHFR transfected lysate(21.5 ...read more
Sandwich ELISA: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Detection limit for recombinant GST tagged DHFR is approximately 0.1ng/ml as a capture antibody.
Folic acid treatment restores endothelial specific DHFR expression and activity in Ang II-infused apoE null mice.DHFR expression (A, n = 8–11) and activity (B, n = 5–7) measured from endothelial cells (ECs) ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, YeSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Dihydrofolate Reductase/DHFR Antibody (2B10) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
DHFR (AAH03584, 88 a.a. ~ 187 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND
Specificity
DHFR (2B10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DHFR
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Sandwich ELISA 1:10-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Control
HeLa Whole Cell Lysate
Publications
Read Publications using
H00001719-M01 in the following applications:

  • WB
    3 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24558445). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Dihydrofolate Reductase/DHFR Antibody (2B10)

  • DHFR
  • DHFRP1
  • Dihydrofolate Reductase
  • DYR
  • EC 1.5.1.3

Background

Dihydrofolate reductase converts dihydrofolate into tetrahydrofolate, a methyl group shuttle required for the de novo synthesis of purines, thymidylic acid, and certain amino acids. While the functional dihydrofolate reductase gene has been mapped to chromosome 5, multiple intronless processed pseudogenes or dihydrofolate reductase-like genes have been identified on separate chromosomes. Dihydrofolate reductase deficiency has been linked to megaloblastic anemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Dihydrofolate Reductase/DHFR Antibody (H00001719-M01)(12)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(3)
All Applications
Filter By Species
Mouse
(2)
All Species
Showing Publications 1 - 10 of 12. Show All 12 Publications.
Publications using H00001719-M01 Applications Species
Huang K, Wang Y, Siu KL et al. Targeting feed-forward signaling of TGF beta/NOX4/DHFR/eNOS uncoupling/TGF beta axis with anti-TGF beta and folic acid attenuates formation of aortic aneurysms: Novel mechanisms and therapeutics Redox Biology [PMID: 33126053] (WB, Mouse) WB Mouse
Li Q, Youn JY, Siu KL et al. Knockout of dihydrofolate reductase in mice induces hypertension and abdominal aortic aneurysm via mitochondrial dysfunction Redox Biology 2019-06-01 [PMID: 30954686] (WB) WB
Cai M, Zhang H, Hou L et al. Inhibiting homologous recombination decreases extrachromosomal amplification but has no effect on intrachromosomal amplification in methotrexate-resistant colon cancer cells. Int J Cancer 2018-08-02 [PMID: 30070702]
Steven S, Oelze M, Hanf A et al. The SGLT2 inhibitor empagliflozin improves the primary diabetic complications in ZDF rats. Redox Biol 2017-06-22 [PMID: 28667906]
Jabs A, Oelze M, Mikhed Y et al. Effect of soluble guanylyl cyclase activator and stimulator therapy on nitroglycerin-induced nitrate tolerance in rats. Vascul Pharmacol 2015-04-11 [PMID: 25869522]
Oelze M, Kroller-Schon S, Welschof P et al. The sodium-glucose co-transporter 2 inhibitor empagliflozin improves diabetes-induced vascular dysfunction in the streptozotocin diabetes rat model by interfering with oxidative stress and glucotoxicity. PLoS One. 2014-11-17 [PMID: 25402275]
Kossmann S, Hu H, Steven S et al. Inflammatory Monocytes Determine Endothelial Nitric Oxide Synthase Uncoupling and Nitro-oxidative Stress Induced by Angiotensin II. J Biol Chem 2014-08-20 [PMID: 25143378]
Siu KL, Miao XN, Cai H. Recoupling of eNOS with Folic Acid Prevents Abdominal Aortic Aneurysm Formation in Angiotensin II-Infused Apolipoprotein E Null Mice. PLoS ONE 2014-02-21 [PMID: 24558445] (WB, Mouse) WB Mouse
Bhabha G, Ekiert DC, Jennewein M et al. Divergent evolution of protein conformational dynamics in dihydrofolate reductase. Nat Struct Mol Biol. 2013-11-01 [PMID: 24077226]
Yoon SA, Choi JR, Kim JO et al. Influence of reduced folate carrier and dihydrofolate reductase genes on methotrexate-induced cytotoxicity. Cancer Res Treat;42(3):163-71. 2010-09-01 [PMID: 20948922]
Show All 12 Publications.

Reviews for Dihydrofolate Reductase/DHFR Antibody (H00001719-M01) (0)

There are no reviews for Dihydrofolate Reductase/DHFR Antibody (H00001719-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dihydrofolate Reductase/DHFR Antibody (H00001719-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Dihydrofolate Reductase/DHFR Products

Research Areas for Dihydrofolate Reductase/DHFR Antibody (H00001719-M01)

Find related products by research area.

Blogs on Dihydrofolate Reductase/DHFR

There are no specific blogs for Dihydrofolate Reductase/DHFR, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dihydrofolate Reductase/DHFR Antibody (2B10) and receive a gift card or discount.

Bioinformatics

Gene Symbol DHFR
Entrez
OMIM
Uniprot