Dihydrofolate Reductase/DHFR Antibody (2B10)

Images

 
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - DHFR monoclonal antibody (M01), clone 2B10. Analysis of DHFR expression in PC-12.
Immunocytochemistry/ Immunofluorescence: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Analysis of monoclonal antibody to DHFR on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - DHFR monoclonal antibody (M01), clone 2B10 Analysis of DHFR expression in HeLa.
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Analysis of DHFR expression in transfected 293T cell line by DHFR monoclonal antibody (M01), clone 2B10.Lane 1: DHFR transfected lysate(21.5 ...read more
Sandwich ELISA: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Detection limit for recombinant GST tagged DHFR is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2B10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Dihydrofolate Reductase/DHFR Antibody (2B10) Summary

Immunogen
DHFR (AAH03584, 88 a.a. - 187 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND
Specificity
DHFR (2B10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DHFR
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Positive Control
HeLa Lysate (NB800-PC1)
Publications
Read Publications using
H00001719-M01 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24558445). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Dihydrofolate Reductase/DHFR Antibody (2B10)

  • DHFR
  • DHFRP1
  • Dihydrofolate Reductase
  • DYR
  • EC 1.5.1.3

Background

Dihydrofolate reductase converts dihydrofolate into tetrahydrofolate, a methyl group shuttle required for the de novo synthesis of purines, thymidylic acid, and certain amino acids. While the functional dihydrofolate reductase gene has been mapped to chromosome 5, multiple intronless processed pseudogenes or dihydrofolate reductase-like genes have been identified on separate chromosomes. Dihydrofolate reductase deficiency has been linked to megaloblastic anemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-87741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB4077
Species: Hu
Applications: WB, IHC
NBL1-10259
Species: Hu
NBP2-48965
Species: Hu
Applications: IHC
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-26616
Species: Hu
Applications: WB, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC

Publications for Dihydrofolate Reductase/DHFR Antibody (H00001719-M01)(8)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species
Showing Publications 1 - 8 of 8.
Publications using H00001719-M01 Applications Species
Jabs A, Oelze M, Mikhed Y et al. Effect of soluble guanylyl cyclase activator and stimulator therapy on nitroglycerin-induced nitrate tolerance in rats. Vascul Pharmacol. 2015 Apr 11 [PMID: 25869522]
Oelze M, Kroller-Schon S, Welschof P et al. The sodium-glucose co-transporter 2 inhibitor empagliflozin improves diabetes-induced vascular dysfunction in the streptozotocin diabetes rat model by interfering with oxidative stress and glucotoxicity. PLoS One. 2014 Nov 17 [PMID: 25402275]
Kossmann S, Hu H, Steven S et al. Inflammatory Monocytes Determine Endothelial Nitric Oxide Synthase Uncoupling and Nitro-oxidative Stress Induced by Angiotensin II. J Biol Chem. 2014 Aug 20 [PMID: 25143378]
Siu KL, Miao XN, Cai H. Recoupling of eNOS with Folic Acid Prevents Abdominal Aortic Aneurysm Formation in Angiotensin II-Infused Apolipoprotein E Null Mice. PLoS ONE 2014 Feb 21 [PMID: 24558445] (WB, Mouse) WB Mouse
Bhabha G, Ekiert DC, Jennewein M et al. Divergent evolution of protein conformational dynamics in dihydrofolate reductase. Nat Struct Mol Biol. 2013 Nov [PMID: 24077226]
Yoon SA, Choi JR, Kim JO et al. Influence of reduced folate carrier and dihydrofolate reductase genes on methotrexate-induced cytotoxicity. Cancer Res Treat;42(3):163-71. 2010 Sep. [PMID: 20948922]
Vodenicharov MD, Laterreur N, Wellinger RJ. Telomere capping in non-dividing yeast cells requires Yku and Rap1. EMBO J. 2010 Jul 13 [PMID: 20628356]
Ionova IA, Vasquez-Vivar J, Whitsett J et al. Deficient BH4 production via de novo and salvage pathways regulates NO responses to cytokines in adult cardiac myocytes. Am J Physiol Heart Circ Physiol. 2008 Oct 03 [PMID: 18835915]

Reviews for Dihydrofolate Reductase/DHFR Antibody (H00001719-M01) (0)

There are no reviews for Dihydrofolate Reductase/DHFR Antibody (H00001719-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dihydrofolate Reductase/DHFR Antibody (H00001719-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Dihydrofolate Reductase/DHFR Products

Bioinformatics Tool for Dihydrofolate Reductase/DHFR Antibody (H00001719-M01)

Discover related pathways, diseases and genes to Dihydrofolate Reductase/DHFR Antibody (H00001719-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dihydrofolate Reductase/DHFR Antibody (H00001719-M01)

Discover more about diseases related to Dihydrofolate Reductase/DHFR Antibody (H00001719-M01).
 

Pathways for Dihydrofolate Reductase/DHFR Antibody (H00001719-M01)

View related products by pathway.

PTMs for Dihydrofolate Reductase/DHFR Antibody (H00001719-M01)

Learn more about PTMs related to Dihydrofolate Reductase/DHFR Antibody (H00001719-M01).
 

Research Areas for Dihydrofolate Reductase/DHFR Antibody (H00001719-M01)

Find related products by research area.

Blogs on Dihydrofolate Reductase/DHFR

There are no specific blogs for Dihydrofolate Reductase/DHFR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dihydrofolate Reductase/DHFR Antibody (2B10) and receive a gift card or discount.

Bioinformatics

Gene Symbol DHFR
Entrez
OMIM
Uniprot