Cofilin Antibody (1A1)

Images

 
Western Blot: Cofilin Antibody (1A1) [H00001072-M04] - Analysis of CFL1 expression in Raw 264.7 (Cat # L024V1).
Immunocytochemistry/ Immunofluorescence: Cofilin Antibody (1A1) [H00001072-M04] - Analysis of monoclonal antibody to CFL1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: Cofilin Antibody (1A1) [H00001072-M04] - Analysis of monoclonal antibody to CFL1 on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 1.5 ug/ml
Western Blot: Cofilin Antibody (1A1) [H00001072-M04] - Western Blot analysis of CFL1 expression in PC-12(Cat # L012V1 ).
Western Blot: Cofilin Antibody (1A1) [H00001072-M04] - Analysis of CFL1 expression in HeLa (Cat # L013V1).
Western Blot: Cofilin Antibody (1A1) [H00001072-M04] - Analysis of CFL1 expression in NIH/3T3 (Cat # L018V1).
ELISA: Cofilin Antibody (1A1) [H00001072-M04] - Detection limit for recombinant GST tagged CFL1 is approximately 10ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
1A1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cofilin Antibody (1A1) Summary

Immunogen
CFL1 (AAH11005, 1 a.a. - 166 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFAKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEGVKDRCTLAEKLGGSAVISLEGKPL
Specificity
cofilin 1 (non-muscle)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CFL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publications using
H00001072-M04 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cofilin Antibody (1A1)

  • 18 kDa phosphoprotein
  • CFL
  • cofilin 1 (non-muscle)
  • Cofilin, non-muscle isoform
  • cofilin-1
  • p18

Background

Cofilin is a small phosphoinositide sensitive, actin binding protein capable of depolymerizing actin filaments in vitro. Under certain conditions, it fragments the filaments and accelerates actin subunit dissociation from their pointed (minus) ends. Cofilin binds stoichiometrically to monomeric G-actin and to actin protomers in filaments in an apparent pH-dependent, Ca2+- independent manner. Cofilin intercalates between longitudinally associated actin monomers within the filament and distorts its helical twist. Cofilin is ubiquitous in tissues of eukaryotes and is especially abundant in neuronal tissues. It is essential for viability and is important for many cellular processes involving actin remodeling such as motility at the leading edge of cells, polarized cell growth, endocytosis, phagocytosis, cellular activation, cytokinesis, and pathogen intracellular motility

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP2-47561
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90949
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
H00002158-M01
Species: Hu
Applications: WB, ELISA, IP, RNAi
AF4937
Species: Hu
Applications: WB, IHC

Publications for Cofilin Antibody (H00001072-M04)(4)

Reviews for Cofilin Antibody (H00001072-M04) (0)

There are no reviews for Cofilin Antibody (H00001072-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cofilin Antibody (H00001072-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Cofilin Antibody (H00001072-M04)

Discover related pathways, diseases and genes to Cofilin Antibody (H00001072-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cofilin Antibody (H00001072-M04)

Discover more about diseases related to Cofilin Antibody (H00001072-M04).
 

Pathways for Cofilin Antibody (H00001072-M04)

View related products by pathway.

PTMs for Cofilin Antibody (H00001072-M04)

Learn more about PTMs related to Cofilin Antibody (H00001072-M04).
 

Research Areas for Cofilin Antibody (H00001072-M04)

Find related products by research area.

Blogs on Cofilin.

ACTB - an abundant cytoskeletal component with applications for gene expression analysis
Actin is the widely studied and ubiquitous cytoskeletal protein capable of forming dynamic microfilament structures. These filaments are essential for diverse cellular functions including cell shape, migration, cytokinesis, and intracellular traffi...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cofilin Antibody (1A1) and receive a gift card or discount.

Bioinformatics

Gene Symbol CFL1
Entrez
OMIM
Uniprot