ITPA Antibody

Images

 
Western Blot: ITPA Antibody [NBP1-88296] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: ITPA Antibody [NBP1-88296] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: ITPA Antibody [NBP1-88296] - Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ITPA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLAA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITPA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ITPA Protein (NBP1-88296PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ITPA Antibody

  • C20orf37
  • dJ794I6.3
  • EC 3.6.1
  • EC 3.6.1.19
  • HLC14-06-P
  • inosine triphosphatase (nucleoside triphosphate pyrophosphatase)
  • Inosine triphosphatase
  • inosine triphosphatase-A
  • inosine triphosphate pyrophosphatase
  • inosine triphosphate pyrophosphohydrolase
  • ITPase
  • My049 protein
  • nucleoside triphosphate diphosphatase
  • Putative oncogene protein hlc14-06-p

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-02356
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-87003
Species: Hu, Rt
Applications: WB, IP, PLA
NBP1-59662
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-88296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ITPA Antibody (NBP1-88296) (0)

There are no publications for ITPA Antibody (NBP1-88296).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ITPA Antibody (NBP1-88296) (0)

There are no reviews for ITPA Antibody (NBP1-88296). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ITPA Antibody (NBP1-88296) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ITPA Products

Bioinformatics Tool for ITPA Antibody (NBP1-88296)

Discover related pathways, diseases and genes to ITPA Antibody (NBP1-88296). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITPA Antibody (NBP1-88296)

Discover more about diseases related to ITPA Antibody (NBP1-88296).
 

Pathways for ITPA Antibody (NBP1-88296)

View related products by pathway.

PTMs for ITPA Antibody (NBP1-88296)

Learn more about PTMs related to ITPA Antibody (NBP1-88296).

Blogs on ITPA

There are no specific blogs for ITPA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ITPA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITPA