ITPA Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ITPA Antibody [NBP1-88296] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells.

Staining of human duodenum shows weak granular cytoplasmic positivity in glandular cells.

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Staining of human liver shows weak granular cytoplasmic positivity in hepatocytes.

Analysis in human cell line HEL.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ITPA Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLAA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITPA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ITPA Protein (NBP1-88296PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ITPA Antibody - BSA Free

• C20orf37
• dJ794I6.3
• EC 3.6.1
• EC 3.6.1.19
• HLC14-06-P
• inosine triphosphatase (nucleoside triphosphate pyrophosphatase)
• Inosine triphosphatase
• inosine triphosphatase-A
• inosine triphosphate pyrophosphatase
• inosine triphosphate pyrophosphohydrolase
• ITPase
• My049 protein
• nucleoside triphosphate diphosphatase
• Putative oncogene protein hlc14-06-p

Background

ITPA is encoded by this gene hydrolyzes inosine triphosphate and deoxyinosine triphosphate to the monophosphate nucleotide and diphosphate. The encoded protein, which is a member of the HAM1 NTPase protein family, is found in the cytoplasm and acts as a homodimer. Defects in the encoded protein can result in inosine triphosphate pyrophosphorylase deficiency. Two transcript variants encoding two different isoforms have been found for this gene. Also, at least two other transcript variants have been identified which are probably regulatory rather than protein-coding. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITPA