IMP Dehydrogenase 2/IMPDH2 Antibody

Images

 
Western Blot: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1, using Anti-IMPDH2 antibody. Remaining relative intensity is ...read more
Immunocytochemistry/ Immunofluorescence: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Staining of human cell line A-431 shows localization to cytosol & rods & rings.
Immunohistochemistry-Paraffin: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Staining of human breast shows moderate cytoplasmic and nuclear positivity in glandular cells.
Western Blot: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Analysis in human cell line U-251 MG.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IMP Dehydrogenase 2/IMPDH2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IMPDH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
IMP Dehydrogenase 2/IMPDH2 Protein (NBP1-86177PEP)
Publications
Read Publications using
NBP1-86177 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24139804).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IMP Dehydrogenase 2/IMPDH2 Antibody

  • EC 1.1.1.205
  • IMDH2
  • IMP (inosine 5'-monophosphate) dehydrogenase 2
  • IMP (inosine monophosphate) dehydrogenase 2
  • IMP Dehydrogenase 2
  • IMP Oxireductase 2
  • IMPD 2
  • IMPD2
  • IMPD2IMP oxireductase 2
  • IMPDH 2
  • IMPDH2
  • IMPDH-II
  • inosine 5' phosphate dehydrogenase 2
  • inosine monophosphate dehydrogenase type II
  • inosine-5'-monophosphate dehydrogenase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8554
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
H00001072-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IP, In vitro
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00007150-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-88296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-87741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP2-03825
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-86177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)(4)

Reviews for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177) (0)

There are no reviews for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IMP Dehydrogenase 2/IMPDH2 Products

Bioinformatics Tool for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)

Discover related pathways, diseases and genes to IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)

Discover more about diseases related to IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177).
 

Pathways for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)

View related products by pathway.

PTMs for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)

Learn more about PTMs related to IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177).
 

Research Areas for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)

Find related products by research area.

Blogs on IMP Dehydrogenase 2/IMPDH2

There are no specific blogs for IMP Dehydrogenase 2/IMPDH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IMP Dehydrogenase 2/IMPDH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IMPDH2
Entrez
Uniprot