Home » IMP Dehydrogenase 2/IMPDH2 » IMP Dehydrogenase 2/IMPDH2 Antibodies » IMP Dehydrogenase 2/IMPDH2 Antibody

IMP Dehydrogenase 2/IMPDH2 Antibody

 (4 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1, using Anti-IMPDH2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB
Genetic Strategies: Western Blot: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1, using Anti-IMPDH2 antibody. Remaining ...read more
Immunocytochemistry/ Immunofluorescence: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Staining of human cell line A-431 shows localization to cytosol & rods & rings.
Immunohistochemistry-Paraffin: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Staining of human breast shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

IMP Dehydrogenase 2/IMPDH2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKD
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IMPDH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 24139804). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
IMP Dehydrogenase 2/IMPDH2 Recombinant Protein Antigen (NBP1-86177PEP)
Publications
Read Publications using
NBP1-86177 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24139804).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IMP Dehydrogenase 2/IMPDH2 Antibody

  • EC 1.1.1.205
  • IMDH2
  • IMP (inosine 5'-monophosphate) dehydrogenase 2
  • IMP (inosine monophosphate) dehydrogenase 2
  • IMP Dehydrogenase 2
  • IMP Oxireductase 2
  • IMPD 2
  • IMPD2
  • IMPD2IMP oxireductase 2
  • IMPDH 2
  • IMPDH2
  • IMPDH-II
  • inosine 5' phosphate dehydrogenase 2
  • inosine monophosphate dehydrogenase type II
  • inosine-5'-monophosphate dehydrogenase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

IMPDH1 Antibody
[Unconjugated]
AF8554
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and BaF3 mouse pro-B cell line. PVDF membrane was probed with 1:1000 dilution of Rabbit Anti-Human/Mouse/Rat IMP Dehydrogenase 1/IMPDH1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8554) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). Specific bands were detected for IMP Dehydrogenase 1/IMPDH1 at approximately 55-57 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
IMP Dehydrogenase 1/IMPDH1 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Rabbit Anti-Human/Mouse/Rat IMP Dehydrogenase 1/IMPDH1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8554) at a 1:200 dilution for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI(blue). Specific staining was localized to cytoplasm and nucleus. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
TLR2 Antibody
(TL2.1) - BSA Free
NB100-56722
Flow (Cell Surface): TLR2 Antibody (TL2.1) [NB100-56722] - Flow (Cell Surface): - Azide Free [NB100-56726] - Analysis using the PE conjugate of NB100-56726. Staining of TLR2 on stable transfected cell line using this antibody at 1 ug/10^6 cells. Green: isotype control. Red: anti-TLR2 antibody. Image using the Azide Free form of this antibody.
Flow Cytometry: TLR2 Antibody (TL2.1) [NB100-56722] - Monitoring of TLR2 expression in normal B cells and primary MCL cells cultured for 24h in the absence/presence of CD40L, IL-4, and TLR ligands. Filled curves refer to isotypic control, empty curves to the TLR2 antibody (NB100-56722) of untreated samples. Dotted histograms represent CD40L+IL4 activated cells, dashed curves indicate CD40L+IL4 activated cells further treated with TLR ligands. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0153823) licensed under a CC-BY licence.
Block/Neutralize: TLR2 Antibody (TL2.1) [NB100-56722] - Human monocyte-derived DCs were pre-incubated wit TLR-neutralizing antibodies including TLR2 antibody (NB100-56722) for 1 h. Afterwards, DCs were infected with H. pylori G27 (MOI 5) and the levels of the costimulatory molecule CD86 and the maturation marker CD83 were analyzed by FACS on CD11c+ cells 24 h post-infection. Data are presented as mean +/- SD of five independent experiments. *p<=0.05, **p<=0.005, ***p<=0.0005. Asterisks on top of bars indicate significance relative to non-neutralized, H. pylori-primed control cells. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0104804) licensed under a CC-BY licence.
(62 Publications)
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
Cofilin Antibody
(1A1)
H00001072-M04
Western Blot: Cofilin Antibody (1A1) [H00001072-M04] - Analysis of CFL1 expression in NIH/3T3 (Cat # L018V1).
Western Blot: Cofilin Antibody (1A1) [H00001072-M04] - Western Blot analysis of CFL1 expression in PC-12(Cat # L012V1 ).
ELISA: Cofilin Antibody (1A1) [H00001072-M04] - Detection limit for recombinant GST tagged CFL1 is approximately 10ng/ml as a capture antibody.
(4 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Park7/DJ-1 Antibody
NB300-270
Immunohistochemistry-Paraffin: Park7/DJ-1 Antibody [NB300-270] - Park7(DJ-1) detected in paraffin embedded human cortex.
Western Blot: Park7/DJ-1 Antibody [NB300-270] - Lysates of the human RPE cell lines ARPE-19 (lane 1) and D407 (lane 2), the mouse RPE cell line B6-RPE07 (lane 3), mouse primary RPE (lane 4) and mouse brain lysates (lane 5) were harvested and analyzed by immunoblot assay with DJ-1 antibody. The DJ-1 signal varied in intensity in each RPE cell culture. Each lane contained 20 ug of protein. Protein loads were confirmed in replicate blots probed with GAPDH. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0067983), licensed under a CC-BY licence.
Western Blot: Park7/DJ-1 Antibody [NB300-270] - ARPE-19 and D407 monolayers were treated with increasing concentrations (0 to 800 uM) of H2O2 for 18 hrs (B), harvested, and analyzed by immunoblot assay with DJ-1 antibody (upper panel). Each lane contained 20 ug of protein. Protein loadings were confirmed in replicate blots probed with GAPDH (lower panel). A representative Western is shown. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0067983), licensed under a CC-BY licence
(3 Reviews)
(20 Publications)
Species: Ch, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, In vitro, Simple Western, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Analysis of HeLa cell culture. Antibody at 1:10,000 in green, and costained with mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Immunohistochemistry-Frozen: Vimentin Antibody [NB300-223] - 10 um Cryosections from PFA fixed murine brain acute slices stained with Vimentin antibody (1:600) and Alexa Fluor 488 anti chicken IgG. Antibody showed specific staining, also of blood vessels. IHC-Fr image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Human A7 cells. Cells were fixed with 10% formalin and permeabilized with 0.1% TritonX-100. After blocking, cells were incubated with primary antibody (1:600) at 4C O/N followed with Alexa Fluor 488 labeled secondary antibody and counterstained with DAPI and Phalloidin for nuclei and F-actin respectively. Imaged with Leica TCS SP5 confocal microscope. ICC/IF image submitted by a verified customer review.
(6 Reviews)
(54 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MDR1/ABCB1
Antibody (SN06-42)
NBP2-67667
Immunohistochemistry-Paraffin: MDR1/ABCB1 Antibody (SN06-42) [NBP2-67667] - Analysis of paraffin-embedded human liver tissue using anti-P Glycoprotein antibody. Counter stained with hematoxylin.
Immunohistochemistry-Frozen: MDR1/ABCB1 Antibody (SN06-42) [NBP2-67667] - Mouse (B6) liver tissue. Fixed in ice-cold methanol for 10 minutes. Blocking in 10% serum and 1% BSA. Primary antibody at 5 ug/mL, overnight incubation. Secondary antibody at 2 ug/mL for 1.5 hour (Invitrogen A-11012). Mounting with Vector Vectashield with DAPI. Image from a verified customer review.
Immunohistochemistry-Paraffin: MDR1/ABCB1 Antibody (SN06-42) [NBP2-67667] - Analysis of paraffin-embedded mouse kidney tissue using anti-P Glycoprotein antibody. Counter stained with hematoxylin.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
RPLP1 Antibody
NBP1-81293
Immunohistochemistry-Paraffin: RPLP1 Antibody [NBP1-81293] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: RPLP1 Antibody [NBP1-81293] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: RPLP1 Antibody [NBP1-81293] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Galectin-1
Antibody [Unconjugate
AF1152
Human peripheral blood monocytes were stained with Mouse Anti-Human CD14 PE-conjugated Monoclonal Antibody (Catalog # FAB3832P) and either (A) Normal Goat IgG Control (Catalog # AB-108-C) or (B) Goat Anti-Human Galectin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1152) followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and A549 human lung carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Galectin‑1 at approximately 17 kDa (as indicated) using 1 µg/mL of Goat Anti-Human Galectin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1152) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Galectin‑1 was detected in immersion fixed paraffin-embedded sections of human prostate cancer tissue using 1.7 µg/mL Goat Anti-Human Galectin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1152) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(5 Reviews)
(12 Publications)
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
CD77 Synthase
Antibody
NBP1-90824
Immunocytochemistry/Immunofluorescence: CD77 Synthase Antibody [NBP1-90824] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.
Western Blot: CD77 Synthase Antibody [NBP1-90824] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402588)
Species: Hu
Applications: ICC/IF, WB
HPRT Antibody
NBP1-33527
Western Blot: HPRT Antibody [NBP1-33527] - Wild-type (WT) and HPRT knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with HPRT antibody diluted at 1:2000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: HPRT Antibody [NBP1-33527] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with HPRT antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunohistochemistry-Paraffin: HPRT Antibody [NBP1-33527] - Paraffin-embedded human endometrial cancer. HPRT antibody) diluted at 1:500.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Topoisomerase I
Antibody
NBP1-90365
Immunocytochemistry/Immunofluorescence: Topoisomerase I Antibody [NBP1-90365] - Staining of human cell line U-2 OS shows localization to nucleus and nucleoli fibrillar center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Analysis in human placenta and skeletal muscle tissues. Corresponding TOP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody [NBP1-90365] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PLA, WB
ITPA Antibody
NBP1-88296
Immunohistochemistry-Paraffin: ITPA Antibody [NBP1-88296] - Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: ITPA Antibody [NBP1-88296] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Western Blot: ITPA Antibody [NBP1-88296] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Cyclophilin A
Antibody [Unconjugate
AF3589
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and C2C12 mouse myoblast cell line, loaded at 0.2 mg/mL. A specific band was detected for Cyclophilin A at approximately 25 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Cyclophilin A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3589) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, C2C12 mouse myoblast cell line, and Nb2‑11 rat lymphoma cell line. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human Cyclophilin A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3589) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Cyclophilin A at approximately 18 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Cyclophilin A was detected in immersion fixed PANC-1 human pancreatic carcinoma cell line using Goat Anti-Human/Mouse/Rat Cyclophilin A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3589) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the Northern­Lights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Dihydrofolate
Reductase/DHFR Antibo ...
H00001719-M01
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Analysis of DHFR expression in transfected 293T cell line by DHFR monoclonal antibody (M01), clone 2B10.Lane 1: DHFR transfected lysate(21.5 KDa).Lane 2: Non-transfected lysate.
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Folic acid treatment restores endothelial specific DHFR expression and activity in Ang II-infused apoE null mice.DHFR expression (A, n?=?8-11) and activity (B, n?=?5-7) measured from endothelial cells (ECs) and EC-denuded aortas isolated from apoE null mice after 4 weeks of infusion. Data show that DHFR expression and activity was restored in FA treated animals specifically in the endothelial cells. eNOS was stained to show that isolation/removal of ECs from the vessels was successful. *p<0.05. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0088899) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Analysis of monoclonal antibody to DHFR on HeLa cell. Antibody concentration 10 ug/ml.
(13 Publications)
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, S-ELISA, WB
Metaxin 1 Antibody
NBP1-87741
Immunocytochemistry/Immunofluorescence: Metaxin 1 Antibody [NBP1-87741] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Metaxin 1 Antibody [NBP1-87741] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and leydig cells.
Immunohistochemistry-Paraffin: Metaxin 1 Antibody [NBP1-87741] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AKR1B1 Antibody
NBP1-89146
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining in human adrenal gland and cerebral cortex tissues using anti-AKR1B1 antibody. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Analysis in human adrenal gland and liver tissues. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on Jurkat cells with c-Myc Antibody (9E10) NB600-302R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Western Blot: c-Myc Antibody (9E10) [NB600-302] - CtIP is phosphorylated by CDKs at multiple sites. Myc-BRCA1 and/or HA-CtIP WT or indicated mutants were expressed in 293T cells and co-immunoprecipitation was performed. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pgen.1003277) licensed under a CC-BY licence.
(4 Reviews)
(36 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Calreticulin
Antibody - BSA Free
NB600-101
Knockdown Validated: Calreticulin Antibody [NB600-101] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Calreticulin knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1500 of Rabbit Anti-Human Calreticulin Polyclonal Antibody (Catalog # NB600-101) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for Calreticulin at approximately 55 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Calreticulin Antibody [NB600-101] - Human kidney lysate.
Immunocytochemistry/Immunofluorescence: Calreticulin Antibody [NB600-101] - The Calreticulin antibody NB600-101 was tested in HeLa cells at a 1:250 dilution against DyLight 488 (Green). Alpha-tubulin and nuclei were counterstained against DyLight 550 (Red) and DAPI (Blue), respectively.
(26 Publications)
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
UQCRC1 Antibody
(OTI1G6)
NBP2-03825
Flow Cytometry: UQCRC1 Antibody (1G6) [NBP2-03825] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-UQCRC1 antibody, and then analyzed by flow cytometry.
Immunohistochemistry-Paraffin: UQCRC1 Antibody (1G6) [NBP2-03825] - Staining of paraffin-embedded Carcinoma of Human liver tissue using anti-UQCRC1 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: UQCRC1 Antibody (1G6) [NBP2-03825] - Staining of paraffin-embedded Carcinoma of Human lung tissue using anti-UQCRC1 mouse monoclonal antibody.
(2 Publications)
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
IMP Dehydrogenase
2/IMPDH2 Antibody
NBP1-86177
IMP Dehydrogenase 2/IMPDH2 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)(4)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177) (0)

There are no reviews for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IMP Dehydrogenase 2/IMPDH2 Products

Bioinformatics Tool for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)

Discover related pathways, diseases and genes to IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)

Discover more about diseases related to IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177).
 

Pathways for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)

View related products by pathway.

PTMs for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)

Learn more about PTMs related to IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177).
 

Research Areas for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)

Find related products by research area.

Blogs on IMP Dehydrogenase 2/IMPDH2

There are no specific blogs for IMP Dehydrogenase 2/IMPDH2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IMP Dehydrogenase 2/IMPDH2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol IMPDH2
Entrez
Uniprot