Home » IMP Dehydrogenase 2/IMPDH2 » IMP Dehydrogenase 2/IMPDH2 Antibodies » IMP Dehydrogenase 2/IMPDH2 Antibody

IMP Dehydrogenase 2/IMPDH2 Antibody

 (4 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1, using Anti-IMPDH2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB
Genetic Strategies: Western Blot: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1, using Anti-IMPDH2 antibody. Remaining ...read more
Immunocytochemistry/ Immunofluorescence: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Staining of human cell line A-431 shows localization to cytosol & rods & rings.
Immunohistochemistry-Paraffin: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Staining of human breast shows moderate cytoplasmic and nuclear positivity in glandular cells.
Western Blot: IMP Dehydrogenase 2/IMPDH2 Antibody [NBP1-86177] - Analysis in human cell line U-251 MG.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

IMP Dehydrogenase 2/IMPDH2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKD
Specificity
Specificity of human IMP Dehydrogenase 2/IMPDH2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IMPDH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
IMP Dehydrogenase 2/IMPDH2 Protein (NBP1-86177PEP)
Publications
Read Publications using
NBP1-86177 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24139804).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IMP Dehydrogenase 2/IMPDH2 Antibody

  • EC 1.1.1.205
  • IMDH2
  • IMP (inosine 5'-monophosphate) dehydrogenase 2
  • IMP (inosine monophosphate) dehydrogenase 2
  • IMP Dehydrogenase 2
  • IMP Oxireductase 2
  • IMPD 2
  • IMPD2
  • IMPD2IMP oxireductase 2
  • IMPDH 2
  • IMPDH2
  • IMPDH-II
  • inosine 5' phosphate dehydrogenase 2
  • inosine monophosphate dehydrogenase type II
  • inosine-5'-monophosphate dehydrogenase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

IMPDH1 Antibody
[Unconjugated]
AF8554
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and BaF3 mouse pro-B cell line. PVDF membrane was probed with 1:1000 dilution of Rabbit Anti-Human/Mouse/Rat IMP Dehydrogenase 1/IMPDH1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8554) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). Specific bands were detected for IMP Dehydrogenase 1/IMPDH1 at approximately 55-57 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
IMP Dehydrogenase 1/IMPDH1 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Rabbit Anti-Human/Mouse/Rat IMP Dehydrogenase 1/IMPDH1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8554) at a 1:200 dilution for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI(blue). Specific staining was localized to cytoplasm and nucleus. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu, Mu, Rt
Applications: WB, ICC
TLR2 Antibody
(TL2.1)
NB100-56722
Western Blot: TLR2 Antibody (TL2.1) [NB100-56722] - Using the Biotin direct conjugate Detection of TLR2 mRNA in multiple cell lines. No detection was observed in L363 or Fravel cell lines. [PMID: 23593278]
Flow Cytometry: TLR2 Antibody (TL2.1) [NB100-56722] - Analysis using the PE conjugate of NB100-56726. Staining of TLR2 on PBMC using this antibody at 1 ug/10^6 cells. Green represents isotype control this antibody; red represents anti-TLR2 antibody.
Flow Cytometry: TLR2 Antibody (TL2.1) [NB100-56722] - Analysis using Azide Free version of NB100-56722. Intracellular TLR2 in 10^6 PBMs using 2 ug of TLR2 antibody. Shaded histogram represents cells without antibody; green represents isotype control ; red represents TLR2 antibody. goat anti-mouse IgG FITC se
(58 Publications)
Species: Hu, Ca
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP, Flow-CS
Cofilin Antibody
(1A1)
H00001072-M04
Western Blot: Cofilin Antibody (1A1) [H00001072-M04] - Analysis of CFL1 expression in Raw 264.7 (Cat # L024V1).
Immunocytochemistry/Immunofluorescence: Cofilin Antibody (1A1) [H00001072-M04] - Analysis of monoclonal antibody to CFL1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: Cofilin Antibody (1A1) [H00001072-M04] - Analysis of monoclonal antibody to CFL1 on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 1.5 ug/ml
(4 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
Park7/DJ-1 Antibody
NB300-270
Western Blot: Park7/DJ-1 Antibody [NB300-270] - Cells were transfected with the pCMV6-ENTRY control (lane 1) or pCMV6-ENTRY PARK7 cDNA (lane 2) for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Park7(DJ-1).
Immunohistochemistry-Paraffin: Park7/DJ-1 Antibody [NB300-270] - Park7(DJ-1) detected in paraffin embedded human cortex.
Western Blot: Park7/DJ-1 Antibody [NB300-270] - Human HEK293 cells and mouse brain lysates.
(2 Reviews)
(15 Publications)
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, ICC/IF, IHC-P, IP, In vitro
Vimentin Antibody
NB300-223
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - analysis of HeLa cell culture stained with chicken pAb to vimentin, NB300-223, dilution 1:10,000 in green, and costained with EnCor mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Vimentin Antibody [NB300-223] - Analysis of tissue and cell lysates using chicken pAb to Vimentin, NB300-223, dilution 1:5,000 in red. [1] protein standard (red), [2] rat whole brain lysate, [3] HeLa, [4] SH-SY5Y, [5] HEK293, and [6] NIH-3T3 cell lysates. NB300-223 binds to the vimentin protein showing a single band at ~50 kDa. The blot was simultaneously probed with mouse mAb to MAP2C/D, dilution 1:5,000 in green, revealing multiple bands around 280kDa that correspond to full length MAP2A/2B isotypes, and ~70kDa bands which are MAP2C/D isotypes. MAP2 isotypes are seen only in extracts containing neuronal lineage cells.
(1 Review)
(22 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
MDR1/ABCB1 Antibody
NB100-80870
Western Blot: MDR1/ABCB1 Antibody [NB100-80870] - Analyis of anti-ABCB1 antibody shows detection of ABCB1 in crude membrane extracts from HF insect cells over-expressing human ABCB1. The extract was loaded onto a gel in the amounts indicated followed by electrophoresis and transfer to nitrocellulose. The membrane was probed with the primary antibody diluted to 1:600, followed by Peroxidase Conjugated Affinity Purified Anti-RABBIT IgG at 1:10000. Personal Communication, Anna Calcagno, CCR-NCI, Bethesda, MD.
Immunohistochemistry-Paraffin: MDR1/ABCB1 Antibody [NB100-80870] - Staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
(1 Review)
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
RPLP1 Antibody
NBP1-81293
Western Blot: RPLP1 Antibody [NBP1-81293] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: RPLP1 Antibody [NBP1-81293] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RPLP1 Antibody [NBP1-81293] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Galectin-1
Antibody [Unconjugate
AF1152
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and A549 human lung carcinoma cell line. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human Galectin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1152) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Galectin‑1 at approximately 14 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Galectin‑1 was detected in immersion fixed paraffin-embedded sections of human prostate cancer tissue using 1.7 µg/mL Goat Anti-Human Galectin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1152) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Human peripheral blood monocytes were stained with Mouse Anti-Human CD14 PE-conjugated Monoclonal Antibody (Catalog # FAB3832P) and either (A) Normal Goat IgG Control (Catalog # AB-108-C) or (B) Goat Anti-Human Galectin‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1152) followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(4 Reviews)
(9 Publications)
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
CD77 Synthase
Antibody
NBP2-57614
Immunocytochemistry/Immunofluorescence: CD77 Synthase Antibody [NBP2-57614] - Staining of human cell line U-2 OS shows localization to nuclear bodies & mitochondria.
Species: Hu
Applications: ICC/IF
HPRT Antibody
NBP1-33527
Western Blot: HPRT Antibody [NBP1-33527] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with HPRT antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: HPRT Antibody [NBP1-33527] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: HPRT Antibody [NBP1-33527] - Paraffin-embedded rat colon. HPRT antibody diluted at 1:500.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Topoisomerase I
Antibody (1A1)
H00007150-M01
Western Blot: Topoisomerase I Antibody (1A1) [H00007150-M01] - TOP1 monoclonal antibody (M01), clone 1A1. Analysis of TOP1 expression in JAR.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody (1A1) [H00007150-M01] - Analysis of monoclonal antibody to TOP1 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1~10 ug/ml.
Western Blot: Topoisomerase I Antibody (1A1) [H00007150-M01] - TOP1 monoclonal antibody (M01), clone 1A1. Analysis of TOP1 expression in HeLa.
(2 Publications)
Species: Hu
Applications: WB, ELISA, IHC-P
ITPA Antibody
NBP1-88296
Western Blot: ITPA Antibody [NBP1-88296] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: ITPA Antibody [NBP1-88296] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ITPA Antibody [NBP1-88296] - Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Cyclophilin A
Antibody [Unconjugate
AF3589
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, C2C12 mouse myoblast cell line, and Nb2‑11 rat lymphoma cell line. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human Cyclophilin A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3589) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Cyclophilin A at approximately 18 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and C2C12 mouse myoblast cell line, loaded at 0.2 mg/mL. A specific band was detected for Cyclophilin A at approximately 25 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Cyclophilin A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3589) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Cyclophilin A was detected in immersion fixed PANC-1 human pancreatic carcinoma cell line using Goat Anti-Human/Mouse/Rat Cyclophilin A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3589) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the Northern­Lights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Dihydrofolate
Reductase/DHFR Antibo ...
H00001719-M01
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - DHFR monoclonal antibody (M01), clone 2B10. Analysis of DHFR expression in PC-12.
Immunocytochemistry/Immunofluorescence: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - Analysis of monoclonal antibody to DHFR on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: Dihydrofolate Reductase/DHFR Antibody (2B10) [H00001719-M01] - DHFR monoclonal antibody (M01), clone 2B10 Analysis of DHFR expression in HeLa.
(9 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Metaxin 1 Antibody
NBP1-87741
Western Blot: Metaxin 1 Antibody [NBP1-87741] - Analysis in human cell line MCF-7.
Immunocytochemistry/Immunofluorescence: Metaxin 1 Antibody [NBP1-87741] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: Metaxin 1 Antibody [NBP1-87741] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AKR1B1 Antibody
NBP1-89146
Western Blot: AKR1B1 Antibody [NBP1-89146] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: AKR1B1 Antibody [NBP1-89146] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining in human adrenal gland and cerebral cortex tissues using anti-AKR1B1 antibody. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
c-Myc Antibody
NB600-335
Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 used for WB at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NB600-335] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-c-Myc conjugated to Alexa Fluor 488 [NB600-335AF488] at 10ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective. Image from the Alexa Fluor 488 version of this antibody.
Western Blot: c-Myc Antibody [NB600-335] - Analysis using the HRP conjugate of NB600-335. Detection of 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibody used for WB at 0.4 ug/ml (1:25,000).
(1 Review)
(38 Publications)
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Calreticulin
Antibody
NB600-101
Western Blot: Calreticulin Antibody [NB600-101] - Human kidney lysate.
Immunocytochemistry/Immunofluorescence: Calreticulin Antibody [NB600-101] - Immunofluorescence staining of Calreticulin in HCT15 colon cancer cells using NB600-101. Secondary antibody was an Alexa Fluor 488. Photo courtesy of Dr. Birkenkamp Demtroeder, Arhus University Hospital.
Immunohistochemistry-Paraffin: Calreticulin Antibody [NB600-101] - IHC analysis of a formalin fixed and paraffin embedded (FFPE) tissue section of human thyroid gland using 1:50 dilution of Calreticulin antibody. The signal was developed using HRP-DAB based detection method which followed counterstaining of the nuclei with hematoxylin. This representative section shows a strong positivity of Calreticulin in the follicular epithelial cells, wherein the signal was found to be very intense in the perinuclear region of the cells which correlates well with Endoplasmic reticulum localization of this protein. The para-follicular cells, endothelial cells of blood vessels (not the RBCs though) and the loose connective tissue in the section showed a weak cytoplasmic staining. Some staining was observed in the follicles/colloids also which is potentially the secreted form of Calreticulin.
(20 Publications)
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
UQCRC1 Antibody
(OTI1G6)
NBP2-03825
Western Blot: UQCRC1 Antibody (1G6) [NBP2-03825] - Analysis of extracts (35ug) from 9 different cell lines by usin g anti-UQCRC1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry-Paraffin: UQCRC1 Antibody (1G6) [NBP2-03825] - Staining of paraffin-embedded Human prostate tissue using anti-UQCRC1 mouse monoclonal antibody.
Flow Cytometry: UQCRC1 Antibody (1G6) [NBP2-03825] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-UQCRC1 antibody, and then analyzed by flow cytometry.
(1 Publication)
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
IMP Dehydrogenase
2/IMPDH2 Antibody
NBP1-86177
IMP Dehydrogenase 2/IMPDH2 Antibody
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)(4)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177) (0)

There are no reviews for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IMP Dehydrogenase 2/IMPDH2 Products

Bioinformatics Tool for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)

Discover related pathways, diseases and genes to IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)

Discover more about diseases related to IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177).
 

Pathways for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)

View related products by pathway.

PTMs for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)

Learn more about PTMs related to IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177).
 

Research Areas for IMP Dehydrogenase 2/IMPDH2 Antibody (NBP1-86177)

Find related products by research area.

Blogs on IMP Dehydrogenase 2/IMPDH2

There are no specific blogs for IMP Dehydrogenase 2/IMPDH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IMP Dehydrogenase 2/IMPDH2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol IMPDH2
Entrez
Uniprot