IMMP2L Antibody - BSA Free

Western Blot: IMMP2L Antibody [NBP1-79838] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

IMMP2L Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human IMMP2LThe immunogen for this antibody is IMMP2L. Peptide sequence LNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IMMP2L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 20 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for IMMP2L Antibody - BSA Free

• EC 3.4.21
• EC 3.4.21.-
• IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae)
• IMP2 inner mitochondrial membrane protease-like (S. cerevisiae)
• IMP2inner mitochondrial membrane peptidase 2 like
• IMP2-like protein
• IMP2-LIKE
• mitochondrial inner membrane protease subunit 2

Background

IMMP2L is a gene that codes for a protein whose function is to catalyze the removal of transit peptides that are required in order to target protein from the mitochondrial matrix into the inter-membrane space in all tissues except the liver and lung. IMMP2L has a length of 175 amino acids and a weight of approximately 20 kDa, and it has a shorter isoform comprised of 110 amino acids with a weight of approximately 12 kDa. Current studies are being done on diseases and disorders related to this gene including Tourette syndrome and malaria. IMMP2L has also been shown to have interactions with ALDH1B1, GPX4, GUF1, HACL1, and IDO2 in pathways such as the protein export pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IMMP2L
• Uniprot:
  • NP_115938(Human)