![Immunocytochemistry/Immunofluorescence: SPPL2a Antibody [NBP1-87512] - Staining of human cell line U-2 OS shows positivity in cytoplasm.](http://images.novusbio.com/fullsize2/SPPL2a-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87512-img0003.jpg "Immunocytochemistry/Immunofluorescence: SPPL2a Antibody [NBP1-87512] - Staining of human cell line U-2 OS shows positivity in cytoplasm.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLE |
| Specificity | Specificity of human SPPL2a antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SPPL2A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for SPPL2a Antibody (NBP1-87512)Discover more about diseases related to SPPL2a Antibody (NBP1-87512).
| Pathways for SPPL2a Antibody (NBP1-87512)View related products by pathway.
|
PTMs for SPPL2a Antibody (NBP1-87512)Learn more about PTMs related to SPPL2a Antibody (NBP1-87512).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SPPL2A |
![Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize2/SPPL2a-Antibody-Immunohistochemistry-Paraffin-NBP1-87512-img0006.jpg "Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human kidney shows strong granular cytoplasmic positivity in cells of tubules.](http://images.novusbio.com/fullsize2/SPPL2a-Antibody-Immunohistochemistry-Paraffin-NBP1-87512-img0004.jpg "Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human kidney shows strong granular cytoplasmic positivity in cells of tubules.")
![Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human parathyroid gland shows high expression.](http://images.novusbio.com/fullsize2/SPPL2a-Antibody-Immunohistochemistry-Paraffin-NBP1-87512-img0005.jpg "Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human parathyroid gland shows high expression.")
![Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining in human parathyroid gland and skeletal muscle tissues using anti-SPPL2A antibody. Corresponding SPPL2A RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/SPPL2a Antibody-Immunohistochemistry-Paraffin-NBP1-87512-img0007.jpg "Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining in human parathyroid gland and skeletal muscle tissues using anti-SPPL2A antibody. Corresponding SPPL2A RNA-seq data are presented for the same tissues.")
![Western Blot: Signal Peptide Peptidase Antibody [NBP2-32276] - Samples: Whole cell lysate (50 ug) prepared using NETN buffer from HeLa, 293T, and Jurkat cells. Antibodies: Affinity purified rabbit anti-SPP antibody NBP2-32276 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.](http://images.novusbio.com/fullsize2/Signal-Peptide-Peptidase-Antibody-Western-Blot-NBP2-32276-img0001.jpg)
![Immunoprecipitation: Signal Peptide Peptidase Antibody [NBP2-32276] - Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) prepared using NETN buffer from HeLa cells. Antibodies: Affinity purified rabbit anti-SPP antibody NBP2-32276 used for IP at 6 ug per reaction. SPP was also immunoprecipitated by rabbit anti-SPP antibody BL16569. For blotting immunoprecipitated SPP, NBP2-32276 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.](http://images.novusbio.com/fullsize2/Signal-Peptide-Peptidase-Antibody-Immunoprecipitation-NBP2-32276-img0002.jpg)
![Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining in human testis and endometrium tissues using anti-IGF2BP1 antibody. Corresponding IGF2BP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/IGF2BP1-Antibody-Immunohistochemistry-Paraffin-NBP2-38956-img0006.jpg)
![Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize2/IGF2BP1-Antibody-Immunohistochemistry-Paraffin-NBP2-38956-img0004.jpg)
![Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize2/IGF2BP1-Antibody-Immunohistochemistry-Paraffin-NBP2-38956-img0005.jpg)
![Western Blot: IGF2BP2 Antibody (3F9) [NBP2-02627] Analysis of extracts (35ug) from 9 different cell lines by using anti-IGF2BP2 monoclonal antibody.](http://images.novusbio.com/fullsize/IGF2BP2 Antibody (3F9)-Western Blot-NBP2-02627-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: IGF2BP2 Antibody (3F9) [NBP2-02627] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY IGF2BP2.](http://images.novusbio.com/fullsize/IGF2BP2 Antibody (3F9)-Immunocytochemistry-Immunofluorescence-NBP2-02627-img0009.jpg)
![Immunohistochemistry-Paraffin: IGF2BP2 Antibody (3F9) [NBP2-02627] - Staining of paraffin-embedded Human liver tissue using anti-IGF2BP2 mouse monoclonal antibody.](http://images.novusbio.com/fullsize/IGF2BP2 Antibody (3F9)-Immunohistochemistry-Paraffin-NBP2-02627-img0008.jpg)
![Western Blot: Signal peptide peptidase-like 2B Antibody [NBP2-55073] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/fullsize2/Signal peptide peptidase-like 2B Antibody-Western Blot-NBP2-55073-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Signal peptide peptidase-like 2B Antibody [NBP2-55073] - Staining of human cell line SiHa shows localization to nucleoplasm, plasma membrane & centrosome.](http://images.novusbio.com/fullsize2/Signal-peptide-peptidase-like-2B-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55073-img0001.jpg)
![Western Blot: IGF2BP3 Antibody [NBP1-84339] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize2/IGF2BP3-Antibody-Western-Blot-NBP1-84339-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: IGF2BP3 Antibody [NBP1-84339] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/IGF2BP3 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84339-img0009.jpg)
![Immunohistochemistry-Paraffin: IGF2BP3 Antibody [NBP1-84339] - Staining of human placenta shows strong cytoplasmic and nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize2/IGF2BP3-Antibody-Immunohistochemistry-Paraffin-NBP1-84339-img0006.jpg)
![Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.](http://images.novusbio.com/fullsize2/p53-Antibody-(PAb-240)-Western-Blot-NB200-103-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/fullsize2/p53-Antibody-(PAb-240)-Immunocytochemistry-Immunofluorescence-NB200-103-img0004.jpg)
![Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.](http://images.novusbio.com/fullsize2/p53-Antibody-(PAb-240)-Immunohistochemistry-Paraffin-NB200-103-img0005.jpg)
![Western Blot: BRAP Antibody [NBP1-91705] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize2/BRAP-Antibody-Western-Blot-NBP1-91705-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: BRAP Antibody [NBP1-91705] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear membrane & cytosol.](http://images.novusbio.com/fullsize2/BRAP Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91705-img0008.jpg)
![Immunohistochemistry-Paraffin: BRAP Antibody [NBP1-91705] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.](http://images.novusbio.com/fullsize2/BRAP-Antibody-Immunohistochemistry-Paraffin-NBP1-91705-img0002.jpg)
![Western Blot: IMPA1 Antibody [NBP1-83107] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/IMPA1-Antibody-Western-Blot-NBP1-83107-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: IMPA1 Antibody [NBP1-83107] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria.](http://images.novusbio.com/fullsize2/IMPA1 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83107-img0006.jpg)
![Immunohistochemistry-Paraffin: IMPA1 Antibody [NBP1-83107] - Staining of human testis shows strong cytoplasmic and nuclear positivity in seminiferous tubules.](http://images.novusbio.com/fullsize2/IMPA1-Antibody-Immunohistochemistry-Paraffin-NBP1-83107-img0001.jpg)
![Western Blot: SPPL3 Antibody [NBP1-57070] - A549 cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize2/SPPL3 Antibody-Western Blot-NBP1-57070-img0002.jpg)
![Western Blot: p19ARF Antibody [NB200-106] - WB analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.](http://images.novusbio.com/fullsize2/p19ARF-Antibody-Western-Blot-NB200-106-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.](http://images.novusbio.com/fullsize2/p19ARF-Antibody-Immunocytochemistry-Immunofluorescence-NB200-106-img0006.jpg)
![Immunohistochemistry-Paraffin: p19ARF Antibody [NB200-106] - IHC analysis of formalin fixed paraffin-embedded (FFPE) mouse spleen using p19ARF antibody at 10 ug/ml on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear staining in the germinal centers of spleen was observed. Staining was performed by Histowiz.](http://images.novusbio.com/fullsize2/p19ARF-Antibody-Immunohistochemistry-Paraffin-NB200-106-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: MPHOSPH10 Antibody [NBP2-38232] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.](http://images.novusbio.com/fullsize2/MPHOSPH10 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38232-img0004.jpg)
![Immunohistochemistry-Paraffin: MPHOSPH10 Antibody [NBP2-38232] - Staining of human cerebral cortex shows strong nucleolar positivity in neuronal cells.](http://images.novusbio.com/fullsize2/MPHOSPH10-Antibody-Immunohistochemistry-Paraffin-NBP2-38232-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: IMP4 Antibody [NBP2-55739] - Staining of human cell line MCF7 shows localization to nucleoli.](http://images.novusbio.com/fullsize2/IMP4 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-55739-img0001.jpg)
![Western Blot: ITM2B Antibody [NBP1-88354] - Analysis in control (vector only transfected HEK293T lysate) and ITM2B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells.](http://images.novusbio.com/fullsize2/ITM2B-Antibody-Western-Blot-NBP1-88354-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: ITM2B Antibody [NBP1-88354] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus & vesicles.](http://images.novusbio.com/fullsize2/ITM2B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88354-img0008.jpg)
![Immunohistochemistry-Paraffin: ITM2B Antibody [NBP1-88354] - Staining in human cerebral cortex and skeletal muscle tissues. Corresponding ITM2B RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/ITM2B-Antibody-Immunohistochemistry-Paraffin-NBP1-88354-img0012.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")