Home » SPPL2a » SPPL2a Antibodies » SPPL2a Antibody

SPPL2a Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human parathyroid gland shows moderate positivity in glandular cells.
Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human parathyroid gland shows moderate positivity in glandular cells.
Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human kidney shows strong granular cytoplasmic positivity in cells of tubules.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Analysis in human parathyroid gland and cerebral cortex tissues. Corresponding SPPL2A RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human cerebral cortex shows weak positivity.
Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human colon shows moderate membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

SPPL2a Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLE
Specificity
Specificity of human SPPL2a antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPPL2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPPL2a Protein (NBP1-87512PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPPL2a Antibody

  • EC 3.4.23
  • EC 3.4.23.-
  • IMP-3
  • IMP3intramembrane cleaving protease
  • Intramembrane protease 3
  • Presenilin-like protein 2
  • PSL2
  • signal peptide peptidase-like 2A
  • SPPL2a
  • SPP-like 2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

IGF-II/IGF2
[Unconjugated]
292-G2
1 μg/lane of Recombinant Human IGF‑II/IGF2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-II/IGF2 (Catalog # 292‑G2) stimulates cell proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 1.5‑6 ng/mL.
(1 Review)
(36 Publications)
Species: Hu
Recombinant Human
Signal Peptide Peptid ...
H00081502-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: WB
IGF2BP1 Antibody
NBP2-38956
Western Blot: IGF2BP1 Antibody [NBP2-38956] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line CACO-2
Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining in human testis and liver tissues using NBP2-38956 antibody. Corresponding IGF2BP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human endometrium shows no positivity in glandular cells as expected.
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
IMP2/IGF2BP2
Antibody (OTI3F9)
NBP2-02627
Western Blot: IGF2BP2 Antibody (3F9) [NBP2-02627] Analysis of extracts (35ug) from 9 different cell lines by using anti-IGF2BP2 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: IGF2BP2 Antibody (3F9) [NBP2-02627] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY IGF2BP2.
Immunohistochemistry-Paraffin: IGF2BP2 Antibody (3F9) [NBP2-02627] - Staining of paraffin-embedded Human liver tissue using anti-IGF2BP2 mouse monoclonal antibody.
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Signal peptide
peptidase-like 2B Ant ...
NBP1-59510
Western Blot: Signal peptide peptidase-like 2B Antibody [NBP1-59510] - Jurkat cell lysate, concentration 1 ug/ml.
Immunohistochemistry-Paraffin: Signal peptide peptidase-like 2B Antibody [NBP1-59510] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Species: Hu
Applications: WB, IHC, IHC-P
IGF2BP3 Antibody
NBP1-84339
Western Blot: IGF2BP3 Antibody [NBP1-84339] - Analysis in human cell line NTERA-2.
Immunohistochemistry-Paraffin: IGF2BP3 Antibody [NBP1-84339] - Staining of humantonsil shows moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: IGF2BP3 Antibody [NBP1-84339] - Staining of human cervix shows no positivity in squamous epithelial cells as expected.
Species: Hu
Applications: WB, IHC, IHC-P
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
BRAP Antibody
NBP1-91705
Western Blot: BRAP Antibody [NBP1-91705] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: BRAP Antibody [NBP1-91705] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear membrane & cytosol.
Immunohistochemistry-Paraffin: BRAP Antibody [NBP1-91705] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
IMPA1 Antibody
NBP1-83107
Western Blot: IMPA1 Antibody [NBP1-83107] - Analysis in control (vector only transfected HEK293T lysate) and IMPA1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: IMPA1 Antibody [NBP1-83107] - Staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: IMPA1 Antibody [NBP1-83107] - Staining of human testis shows strong cytoplasmic and nuclear positivity in seminiferous tubules.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
SPPL3 GST (N-Term) Pr ...
H00121665-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
p19ARF/CDKN2A
Antibody
NB200-106
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
(1 Review)
(42 Publications)
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MPHOSPH10 Antibody
NBP1-84341
Immunohistochemistry-Paraffin: MPHOSPH10 Antibody [NBP1-84341] - Staining of human cerebral cortex, kidney, skin and testis using Anti-MPHOSPH10 antibody NBP1-84341 (A) shows similar protein distribution across tissues to independent antibody NBP2-38232 (B).
Immunocytochemistry/Immunofluorescence: MPHOSPH10 Antibody [NBP1-84341] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli.
Immunohistochemistry-Paraffin: MPHOSPH10 Antibody [NBP1-84341] - Staining of human testis shows strong positivity in nucleoli in Leydig cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
EGFR Antibody
(DH8.3) - EGFRvIII, M ...
NBP2-50599
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Flow Cytometry: EGFR Antibody (DH8.3) - EGFRvIII [NBP2-50599] - An intracellular stain was performed on A431 cells with EGFR [DH8.3] Antibody NBP2-50599AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
(5 Publications)
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
Recombinant Human
IMMP1L GST (N-Term) P ...
H00196294-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Importin4 Antibody
NBP3-03794
Western Blot: Importin4 Antibody [NBP3-03794] - Analysis of extracts of various cell lines, using Importin4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.
Immunocytochemistry/Immunofluorescence: Importin4 Antibody [NBP3-03794] - Analysis of L929 cells using Importin4 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: Importin4 Antibody [NBP3-03794] - Analysis of C6 cells using Importin4 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Recombinant Human
IMP4 GST (N-Term) Pro ...
H00092856-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
ITM2B Antibody
NBP1-36963
Western Blot: ITM2B Antibody [NBP1-36963] - HepG2 cell lysate (35 ug protein in RIPA buffer). Antibody at 0.3 ug/mL. Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: ITM2B Antibody [NBP1-36963] - Paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton. Primary antibody at 10 ug/mL, 1 hr incubation followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing Golgi apparatus and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10u g/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Immunohistochemistry-Paraffin: ITM2B Antibody [NBP1-36963] - Human small intestine tissue. Antibody at 2.5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
ADAM10
[Unconjugated]
936-AD
ADAM10 [Unconjugated]
(1 Review)
(19 Publications)
Species: Hu
IGFBP-3 [HRP]
DGB300
(3 Reviews)
(33 Publications)
Species: Hu
SPPL2a Antibody
NBP1-87512
SPPL2a Antibody
Species: Hu
Applications: IHC, IHC-P

Publications for SPPL2a Antibody (NBP1-87512) (0)

There are no publications for SPPL2a Antibody (NBP1-87512).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPPL2a Antibody (NBP1-87512) (0)

There are no reviews for SPPL2a Antibody (NBP1-87512). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SPPL2a Antibody (NBP1-87512) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional SPPL2a Products

Bioinformatics Tool for SPPL2a Antibody (NBP1-87512)

Discover related pathways, diseases and genes to SPPL2a Antibody (NBP1-87512). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPPL2a Antibody (NBP1-87512)

Discover more about diseases related to SPPL2a Antibody (NBP1-87512).
 

Pathways for SPPL2a Antibody (NBP1-87512)

View related products by pathway.

PTMs for SPPL2a Antibody (NBP1-87512)

Learn more about PTMs related to SPPL2a Antibody (NBP1-87512).

Blogs on SPPL2a

There are no specific blogs for SPPL2a, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPPL2a Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SPPL2A