SPPL2a Antibody

Images

 
Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human parathyroid gland shows moderate positivity in glandular cells.
Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human kidney shows strong granular cytoplasmic positivity in cells of tubules.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Analysis in human parathyroid gland and cerebral cortex tissues. Corresponding SPPL2A RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human cerebral cortex shows weak positivity.
Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human colon shows moderate membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SPPL2a Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLE
Specificity
Specificity of human SPPL2a antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPPL2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPPL2a Protein (NBP1-87512PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPPL2a Antibody

  • EC 3.4.23
  • EC 3.4.23.-
  • IMP-3
  • IMP3intramembrane cleaving protease
  • Intramembrane protease 3
  • Presenilin-like protein 2
  • PSL2
  • signal peptide peptidase-like 2A
  • SPPL2a
  • SPP-like 2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38956
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-02627
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59510
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84339
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP3-03794
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-36963
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-87512
Species: Hu
Applications: IHC, IHC-P

Publications for SPPL2a Antibody (NBP1-87512) (0)

There are no publications for SPPL2a Antibody (NBP1-87512).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPPL2a Antibody (NBP1-87512) (0)

There are no reviews for SPPL2a Antibody (NBP1-87512). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SPPL2a Antibody (NBP1-87512) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SPPL2a Products

Bioinformatics Tool for SPPL2a Antibody (NBP1-87512)

Discover related pathways, diseases and genes to SPPL2a Antibody (NBP1-87512). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPPL2a Antibody (NBP1-87512)

Discover more about diseases related to SPPL2a Antibody (NBP1-87512).
 

Pathways for SPPL2a Antibody (NBP1-87512)

View related products by pathway.

PTMs for SPPL2a Antibody (NBP1-87512)

Learn more about PTMs related to SPPL2a Antibody (NBP1-87512).

Blogs on SPPL2a

There are no specific blogs for SPPL2a, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPPL2a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPPL2A