SPPL2a Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SPPL2a Antibody [NBP1-87512] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: SPPL2a Antibody [NBP1-87512] - Staining of human kidney shows strong granular cytoplasmic positivity in cells of tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPPL2a Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HASGNGTTKDYCMLYNPYWTALPSTLENATSISLMNLTSTPLCNLSDIPPVGIKSKAVVVPWGSCHFLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPPL2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPPL2a Protein (NBP1-87512PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPPL2a Antibody

  • EC 3.4.23
  • EC 3.4.23.-
  • IMP-3
  • IMP3intramembrane cleaving protease
  • Intramembrane protease 3
  • Presenilin-like protein 2
  • PSL2
  • signal peptide peptidase-like 2A
  • SPPL2a
  • SPP-like 2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32276
Species: Hu
Applications: WB, IP
NBP2-38956
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-55073
Species: Hu
Applications: WB, ICC/IF
NBP1-84339
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32505
Species: Hu
Applications: IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBL1-11978
Species: Hu
NBP2-56986
Species: Hu
Applications: WB, ICC/IF
NBP2-55739
Species: Hu
Applications: ICC/IF
NBP1-88354
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SPPL2a Antibody (NBP1-87512) (0)

There are no publications for SPPL2a Antibody (NBP1-87512).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPPL2a Antibody (NBP1-87512) (0)

There are no reviews for SPPL2a Antibody (NBP1-87512). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SPPL2a Antibody (NBP1-87512) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPPL2a Products

Bioinformatics Tool for SPPL2a Antibody (NBP1-87512)

Discover related pathways, diseases and genes to SPPL2a Antibody (NBP1-87512). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPPL2a Antibody (NBP1-87512)

Discover more about diseases related to SPPL2a Antibody (NBP1-87512).
 

Pathways for SPPL2a Antibody (NBP1-87512)

View related products by pathway.

PTMs for SPPL2a Antibody (NBP1-87512)

Learn more about PTMs related to SPPL2a Antibody (NBP1-87512).

Blogs on SPPL2a

There are no specific blogs for SPPL2a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPPL2a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPPL2A