Caspr2 Antibody

Images

 
Western Blot: Caspr2 Antibody [NBP1-88182] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: Caspr2 Antibody [NBP1-88182] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells and distinct staining of neuropil.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Caspr2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CNKDVGAFFEEGMWLRYNFQAPATNARDSSSRVDNAPDQQNSHPDLAQEEIRFSFSTTKAPCILLYISSFTTDFLAVLVKPTGSLQIRYNLGGTREPYNIDVDHRNMANGQPHSVNITRHEKTIFLKLDHYPSVSYHLPSSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNTNAP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Caspr2 Protein (NBP1-88182PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-88182 in the following applications:

Publications
Read Publication using NBP1-88182.

Reactivity Notes

Mouse (85%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Caspr2 Antibody

  • AUTS15
  • Caspr2
  • CASPR2DKFZp781D1846
  • CDFE
  • Cell recognition molecule Caspr2
  • CNTNAP2
  • contactin associated protein-like 2
  • contactin-associated protein 2
  • contactin-associated protein-like 2
  • homolog of Drosophila neurexin IV
  • KIAA0868
  • NRXN4
  • NRXN4Caspr2
  • PTHSL1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4439
Species: Mu, Rt
Applications: WB, Simple Western, IHC
AF7548
Species: Hu
Applications: IHC
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
NBP1-77320
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
H00003736-B01P
Species: Hu
Applications: WB
NB100-55411
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB110-61027
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, Simple Western
NBP1-42788
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, IP
AF4524
Species: Rt
Applications: WB
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-56410
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB300-546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-82827
Species: Hu
Applications: IHC, IHC-P
NBP1-84717
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-88182
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Caspr2 Antibody (NBP1-88182)(1)

Review for Caspr2 Antibody (NBP1-88182) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-88182:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
YONGJIE LAI
WB Human 09/24/2014
View

Summary

ApplicationWestern Blot
Sample TestedCaspr2 plasmid transfected HEK293T cell lysate
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Caspr2 Antibody (NBP1-88182) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Caspr2 Products

Bioinformatics Tool for Caspr2 Antibody (NBP1-88182)

Discover related pathways, diseases and genes to Caspr2 Antibody (NBP1-88182). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Caspr2 Antibody (NBP1-88182)

Discover more about diseases related to Caspr2 Antibody (NBP1-88182).
 

Pathways for Caspr2 Antibody (NBP1-88182)

View related products by pathway.

PTMs for Caspr2 Antibody (NBP1-88182)

Learn more about PTMs related to Caspr2 Antibody (NBP1-88182).

Blogs on Caspr2

There are no specific blogs for Caspr2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

 
YONGJIE LAI
09/24/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol CNTNAP2
Entrez