Novus Biologicals products are now on bio-techne.com

IGF2BP3 Antibody

Images

 
Western Blot: IGF2BP3 Antibody [NBP1-84339] - Analysis in human cell line NTERA-2.
Immunohistochemistry-Paraffin: IGF2BP3 Antibody [NBP1-84339] - Staining of humantonsil shows moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: IGF2BP3 Antibody [NBP1-84339] - Staining of human cervix shows no positivity in squamous epithelial cells as expected.
Immunohistochemistry-Paraffin: IGF2BP3 Antibody [NBP1-84339] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: IGF2BP3 Antibody [NBP1-84339] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IGF2BP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQ
Predicted Species
Mouse (95%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGF2BP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IGF2BP3 Protein (NBP1-84339PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IGF2BP3 Antibody

  • CT98
  • hKOC
  • IGF II mRNA binding protein 3
  • IGF2 mRNA-binding protein 3
  • IGF-II mRNA-binding protein 3
  • IMP-3KH domain-containing protein overexpressed in cancer
  • IMP3VICKZ family member 3
  • insulin-like growth factor 2 mRNA binding protein 3
  • insulin-like growth factor 2 mRNA-binding protein 3
  • KH domain containing protein overexpressed in cancer
  • KOC1DKFZp686F1078
  • VICKZ3cancer/testis antigen 98

Background

The protein encoded by the IGF2BP3 gene is primarily found in the nucleolus, where it can bind to the 5' UTR of theinsulin-like growth factor II leader 3 mRNA and may repress translation of insulin-like growth factor II during latedevelopment. The encoded protein contains several KH domains, which are important in RNA binding and are known to beinvolved in RNA synthesis and metabolism. A pseudogene exists on chromosome 7, and there are putative pseudogenes onother chromosomes. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

292-G2
Species: Hu
Applications: BA
NBP2-38956
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-32276
Species: Hu
Applications: IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-91705
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83107
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-55073
Species: Hu
Applications: ICC/IF, WB
H00196294-P01
Species: Hu
Applications: ELISA, AP, PA, WB
DGB300
Species: Hu
Applications: ELISA
NBP1-84341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-81591
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00121665-Q01
Species: Hu
Applications: ELISA, AP, PA, WB

Publications for IGF2BP3 Antibody (NBP1-84339) (0)

There are no publications for IGF2BP3 Antibody (NBP1-84339).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGF2BP3 Antibody (NBP1-84339) (0)

There are no reviews for IGF2BP3 Antibody (NBP1-84339). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IGF2BP3 Antibody (NBP1-84339). (Showing 1 - 1 of 1 FAQ).

  1. Could you please let me know about the concentration of NBP1-84339?
    • Our product NBP1-84339 is currently provided at a concentration of 0.2mg/ml.

Secondary Antibodies

 

Isotype Controls

Additional IGF2BP3 Products

Research Areas for IGF2BP3 Antibody (NBP1-84339)

Find related products by research area.

Blogs on IGF2BP3

There are no specific blogs for IGF2BP3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGF2BP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IGF2BP3