ELSPBP1 Antibody


Orthogonal Strategies: Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Analysis in human epididymis and prostate tissues. Corresponding ELSPBP1 RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human cerebral cortex, epididymis, prostate and testis using Anti-ELSPBP1 antibody NBP2-13957 (A) shows similar ...read more
Western Blot: ELSPBP1 Antibody [NBP2-13957] - Analysis in control (vector only transfected HEK293T lysate) and ELSPBP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human epididymis shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human prostate shows no positivity in glandular cells as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ELSPBP1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SCISQGSFLGSLWWSVTSVFDEKQQWKFCETNEYGGNSLRKPCIFPSIYR NNVVSDCMEDESNKLWCPT
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ELSPBP1 Protein (NBP2-13957PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ELSPBP1 Antibody

  • E12epididymal protein 12
  • EDDM12
  • Epididymal secretory protein 12
  • epididymal sperm binding protein 1
  • epididymal sperm-binding protein 1
  • HE12


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
Species: Hu
Applications: ICC, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA, BA
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ELSPBP1 Antibody (NBP2-13957) (0)

There are no publications for ELSPBP1 Antibody (NBP2-13957).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELSPBP1 Antibody (NBP2-13957) (0)

There are no reviews for ELSPBP1 Antibody (NBP2-13957). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELSPBP1 Antibody (NBP2-13957) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ELSPBP1 Products

Bioinformatics Tool for ELSPBP1 Antibody (NBP2-13957)

Discover related pathways, diseases and genes to ELSPBP1 Antibody (NBP2-13957). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

PTMs for ELSPBP1 Antibody (NBP2-13957)

Learn more about PTMs related to ELSPBP1 Antibody (NBP2-13957).

Research Areas for ELSPBP1 Antibody (NBP2-13957)

Find related products by research area.

Blogs on ELSPBP1

There are no specific blogs for ELSPBP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ELSPBP1 Antibody and receive a gift card or discount.


Gene Symbol ELSPBP1