IL12B Antibody (3F3S0)

Western Blot: IL12B Antibody (3F3S0) [NBP3-33402] - Western blot analysis of lysates from 293T-IL12-His(N), using IL12 Rabbit mAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3F3S0
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

IL12B Antibody (3F3S0) Summary

• Description: Novus Biologicals Rabbit IL12B Antibody (3F3S0) (NBP3-33402) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 23-328 of human IL12B (NP_002178.2).
  
  Sequence:
  IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: IL12B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for IL12B Antibody (3F3S0)

• CLMF p40
• CLMF
• CLMF2
• Cytotoxic lymphocyte maturation factor 40 kDa subunit
• IL-12 subunit p40
• IL-12BNK cell stimulatory factor chain 2
• interleukin 12, p40
• interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocytematuration factor 2, p40)
• interleukin-12 beta chain
• interleukin-12 subunit beta
• natural killer cell stimulatory factor, 40 kD subunit
• NKSF
• NKSF2IL12, subunit p40

Background

The IL12B gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encode

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL12B