LANCL1 Antibody

Images

 
Western Blot: LANCL1 Antibody [NBP1-81796] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: LANCL1 Antibody [NBP1-81796] - Immunofluorescent staining of human cell line A-431 shows localization to microtubules.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.
Western Blot: LANCL1 Antibody [NBP1-81796] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human fallopian tube shows moderate positivity in cilia in glandular cells.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human kidney shows weak membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons and neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LANCL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQM
Specificity
Specificity of human, mouse, rat LANCL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LANCL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
LANCL1 Knockout HeLa Cell Lysate
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LANCL1 Antibody

  • 40 kDa erythrocyte membrane protein
  • LanC (bacterial lantibiotic synthetase component C)-like 1
  • LanC (bacterial lantibiotic synthetase component)
  • LanC lantibiotic synthetase component C-like 1 (bacterial)
  • lanC-like protein 1
  • p40GPR69AG protein-coupled receptor 69A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7250
Species: Hu
Applications: IHC
NBP1-89530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-23485
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2428
Species: Hu
Applications: WB
NBP1-92564
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
6507-IL/CF
Species: Hu
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
7270-IL/CF
Species: Hu
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
H00002158-M01
Species: Hu
Applications: WB, ELISA, IP, RNAi
AF4937
Species: Hu
Applications: WB, IHC
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LANCL1 Antibody (NBP1-81796) (0)

There are no publications for LANCL1 Antibody (NBP1-81796).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LANCL1 Antibody (NBP1-81796) (0)

There are no reviews for LANCL1 Antibody (NBP1-81796). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LANCL1 Antibody (NBP1-81796) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LANCL1 Products

Bioinformatics Tool for LANCL1 Antibody (NBP1-81796)

Discover related pathways, diseases and genes to LANCL1 Antibody (NBP1-81796). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LANCL1 Antibody (NBP1-81796)

Discover more about diseases related to LANCL1 Antibody (NBP1-81796).
 

Pathways for LANCL1 Antibody (NBP1-81796)

View related products by pathway.

PTMs for LANCL1 Antibody (NBP1-81796)

Learn more about PTMs related to LANCL1 Antibody (NBP1-81796).

Blogs on LANCL1

There are no specific blogs for LANCL1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LANCL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LANCL1
COVID-19 update