LANCL1 Antibody


Western Blot: LANCL1 Antibody [NBP1-81796] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: LANCL1 Antibody [NBP1-81796] - Immunofluorescent staining of human cell line A-431 shows localization to microtubules.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons and neuropil.
Western Blot: LANCL1 Antibody [NBP1-81796] - Analysis in human cell line SK-BR-3.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human fallopian tube shows moderate positivity in cilia in glandular cells.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human kidney shows weak membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

LANCL1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQM
Specificity of human LANCL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
LANCL1 Knockout HeLa Cell Lysate
Control Peptide
LANCL1 Protein (NBP1-81796PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for LANCL1 Antibody

  • 40 kDa erythrocyte membrane protein
  • LanC (bacterial lantibiotic synthetase component C)-like 1
  • LanC (bacterial lantibiotic synthetase component)
  • LanC lantibiotic synthetase component C-like 1 (bacterial)
  • lanC-like protein 1
  • p40GPR69AG protein-coupled receptor 69A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
Species: Hu
Applications: WB, IHC, IHC-P

Publications for LANCL1 Antibody (NBP1-81796) (0)

There are no publications for LANCL1 Antibody (NBP1-81796).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LANCL1 Antibody (NBP1-81796) (0)

There are no reviews for LANCL1 Antibody (NBP1-81796). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LANCL1 Antibody (NBP1-81796) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional LANCL1 Products

Bioinformatics Tool for LANCL1 Antibody (NBP1-81796)

Discover related pathways, diseases and genes to LANCL1 Antibody (NBP1-81796). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LANCL1 Antibody (NBP1-81796)

Discover more about diseases related to LANCL1 Antibody (NBP1-81796).

Pathways for LANCL1 Antibody (NBP1-81796)

View related products by pathway.

PTMs for LANCL1 Antibody (NBP1-81796)

Learn more about PTMs related to LANCL1 Antibody (NBP1-81796).

Blogs on LANCL1

There are no specific blogs for LANCL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our LANCL1 Antibody and receive a gift card or discount.


Gene Symbol LANCL1