LANCL1 Antibody

Images

 
Western Blot: LANCL1 Antibody [NBP1-81796] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: LANCL1 Antibody [NBP1-81796] - Immunofluorescent staining of human cell line A-431 shows localization to microtubules.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons and neuropil.
Western Blot: LANCL1 Antibody [NBP1-81796] - Analysis in human cell line SK-BR-3.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human fallopian tube shows moderate positivity in cilia in glandular cells.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human kidney shows weak membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LANCL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQM
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LANCL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LANCL1 Protein (NBP1-81796PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LANCL1 Antibody

  • 40 kDa erythrocyte membrane protein
  • LanC (bacterial lantibiotic synthetase component C)-like 1
  • LanC (bacterial lantibiotic synthetase component)
  • LanC lantibiotic synthetase component C-like 1 (bacterial)
  • lanC-like protein 1
  • p40GPR69AG protein-coupled receptor 69A

Background

The LANCL1 gene encodes a peripheral membrane protien related to the LanC family protiens that are invoved in the biosynthesis of antimicrobial peptides. Previously, this protein was thought to be a part of the G-protien-coupled receptor superfamily, but it has been found that it is indeed in the LanC family. The protien might play a role as a peptide-modifying enzyme in eukaryotic cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

1887-ML
Species: Mu
Applications: BA
DY417
Species: Mu
Applications: ELISA
419-ML
Species: Mu
Applications: BA
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-23485
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF2428
Species: Hu
Applications: WB
NBP1-92564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
6507-IL/CF
Species: Hu
Applications: BA
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
DY1975
Species: Hu
Applications: ELISA
202-IL
Species: Hu
Applications: BA
NBP1-90149
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-11884
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, RIA, WB
NBP1-33581
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P
MAB4937
Species: Hu
Applications: CyTOF-ready, ICFlow, WB

Publications for LANCL1 Antibody (NBP1-81796) (0)

There are no publications for LANCL1 Antibody (NBP1-81796).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LANCL1 Antibody (NBP1-81796) (0)

There are no reviews for LANCL1 Antibody (NBP1-81796). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LANCL1 Antibody (NBP1-81796) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LANCL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LANCL1