IL-5 Antibody


Western Blot: IL-5 Antibody [NBP1-69163] - Mouse Spleen lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

IL-5 Antibody Summary

Synthetic peptides corresponding to Il5 (interleukin 5) The peptide sequence was selected from the middle region of Il5. Peptide sequence MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against Il5 and was validated on Western blot.
Theoretical MW
15 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 3
NBP1-69163 in the following application:

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IL-5 Antibody

  • BCDF mu
  • B-cell differentiation factor I
  • EDF
  • Eo-CSF
  • Eosinophil differentiation factor
  • IL5
  • IL-5
  • IL-5T-cell replacing factor
  • interleukin 5 (colony-stimulating factor, eosinophil)
  • interleukin-5
  • TRF
  • TRFB cell differentiation factor I


The function of Il5 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Mu
Applications: WB

Publications for IL-5 Antibody (NBP1-69163) (0)

There are no publications for IL-5 Antibody (NBP1-69163).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for IL-5 Antibody (NBP1-69163) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-69163:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
reviewed by:
WB Mouse 03/17/2017


ApplicationWestern Blot
Sample Tested293T Western Cell lysate


Comments293T cells transfected with mouse IL5 expression plasmid. Supernatant collected, concentrated, and subjected to western analysis. Antibody concentration 0.2 ug/ml. Required 5 min exposure to film with ECL plus reagent. Detected band of expected size ~15 kDa and smaller unknown band.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-5 Antibody (NBP1-69163) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional IL-5 Products

Bioinformatics Tool for IL-5 Antibody (NBP1-69163)

Discover related pathways, diseases and genes to IL-5 Antibody (NBP1-69163). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-5 Antibody (NBP1-69163)

Discover more about diseases related to IL-5 Antibody (NBP1-69163).

Pathways for IL-5 Antibody (NBP1-69163)

View related products by pathway.

PTMs for IL-5 Antibody (NBP1-69163)

Learn more about PTMs related to IL-5 Antibody (NBP1-69163).

Blogs on IL-5

There are no specific blogs for IL-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: WB
Species: Mouse


Gene Symbol IL5