IL-37/IL-1F7 Antibody - BSA Free

Immunohistochemistry-Paraffin: IL-37/IL-1F7 Antibody [NBP2-33712] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: IL-37/IL-1F7 Antibody [NBP2-33712] - Staining of human skin shows moderate cytoplasmic positivity in keratinocytes in stratum granulosum.

Immunohistochemistry-Paraffin: IL-37/IL-1F7 Antibody [NBP2-33712] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IL-37/IL-1F7 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL37
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  IL-37/IL-1F7 Protein (NBP2-33712PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IL-37/IL-1F7 Antibody - BSA Free

• FIL1 zeta
• FIL1
• FIL1(ZETA)
• FIL1ZFIL1 zeta
• IL-1F7
• IL-1F7IL-1 zeta
• IL1H4IL1F7 (canonical product IL-1F7b)
• IL-1H4IL-1F7b (IL-1H4, IL-1H, IL-1RP1)
• IL-1RP1IL-1X protein
• IL1RP1interleukin 1 family member 7
• IL-1X
• IL37
• IL-37
• interleukin 1 family, member 7 (zeta)
• interleukin 1, zeta
• interleukin-1 family member 7
• Interleukin-1 homolog 4
• interleukin-1 superfamily z
• Interleukin-1 zeta
• Interleukin-1-related protein

Background

IL1F7 is encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine can bind to, and may be a ligand for interleukin 18 receptor (IL18R1/IL-1Rrp). This cytokine also binds to interleukin 18 binding protein (IL18BP), an inhibitory binding protein of interleukin 18 (IL18), and subsequently forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL18. This gene along with eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Five alternatively spliced transcript variants encoding distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL37
• Uniprot:
  • Q9NZH6(Human)