Home » Reg1A » Reg1A Antibodies » Reg1A Antibody

Reg1A Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Reg1A Antibody [NBP2-13215] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
Western Blot: Reg1A Antibody [NBP2-13215] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215] - Staining of human liver shows no positivity in hepatocytes as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215] - Analysis in human pancreas and kidney tissues using NBP2-13215 antibody. Corresponding REG1A RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215] - Staining of human kidney shows no positivity in cells in tubules as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Reg1A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSV
Specificity
Specificity of human Reg1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
REG1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Reg1A Recombinant Protein Antigen (NBP2-13215PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Reg1A Antibody

  • ICRF
  • Islet cells regeneration factor
  • Islet of Langerhans regenerating protein
  • lithostathine-1-alpha
  • P19
  • pancreatic stone protein, secretory
  • Pancreatic thread protein
  • protein-X
  • PSP
  • PSPS
  • PSPS1
  • PTP
  • REG
  • Reg1A
  • REG-1-alpha
  • Regenerating islet-derived protein 1-alpha
  • Regenerating protein I alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

p19ARF/CDKN2A
Antibody
NB200-106
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
(1 Review)
(42 Publications)
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(14 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
IL-23A/IL-23 P19
[Unconjugated]
1887-ML
IL-23A/IL-23 P19 [Unconjugated]
(6 Reviews)
(143 Publications)
Species: Mu
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
PTP1B/PTPN1
Antibody [Unconjugate
AF1366
Western blot shows lysates of TF‑1 human erythroleukemic cell line and CHP‑100 human neuroblastoma cell line. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human PTP1B Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1366) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for PTP1B at approximately 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for PTP1B at approximately 57 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human PTP1B Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1366). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
PTP1B was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human PTP1B Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1366) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Specific labeling was localized to the perinuclear region in glandular epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(6 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
Tau [p Thr181]
Antibody
NB100-82245
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Analysis of extracts from mouse brain tissue using Tau(Phospho-Thr181) Antibody and the same antibody preincubated with blocking peptide.
Immunohistochemistry-Paraffin: Tau [p Thr181] Antibody [NB100-82245] - analysis of paraffin-embedded rat hippocampal region tissue from a model with Alzheimer's Disease using Tau (phospho-Thr181) antibody.
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Western blot analysis of extract from mouse brain tissue using Tau (Ab-181) antibody ( Lane 1 and 2) and Tau (phospho-Thr181) antibody ( Lane 3 and 4).
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
p15INK4b/CDKN2B
Antibody (651308) [Un ...
MAB6798
Western blot shows lysates of 293T human embryonic kidney cell line and HeLa human cervical epithelial carcinoma cell line. PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human p15INK4b/CDKN2B Monoclonal Antibody (Catalog # MAB6798) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for p15INK4b/CDKN2B at approximately 15 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
p15INK4b/CDKN2B was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Mouse Anti-Human p15INK4b/CDKN2B Monoclonal Antibody (Catalog # MAB6798) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: WB, ICC
SUB1 Antibody
NBP1-82454
Western Blot: SUB1 Antibody [NBP1-82454] - Analysis in human cell line RPMI-8226.
Immunocytochemistry/Immunofluorescence: SUB1 Antibody [NBP1-82454] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SUB1 Antibody [NBP1-82454] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
D4S234E Antibody
(1C3)
H00027065-M01
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3 Analysis of D4S234E expression in IMR-32.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in PC-12.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in rat brain.
(1 Publication)
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Western Blot: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY TCEAL1.
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human lymphoma tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)(
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: WB, IHC
SHP-1 Antibody
(SR41-02)
NBP2-67321
Western Blot: SHP-1 Antibody (SR41-02) [NBP2-67321] - Analysis of SHP1 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature. Positive control: Lane 1: Raji cell lysate Lane 2: Jurkat cell lysate
Immunocytochemistry/Immunofluorescence: SHP-1 Antibody (SR41-02) [NBP2-67321] - Staining SHP1 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: SHP-1 Antibody (SR41-02) [NBP2-67321] - Analysis of paraffin-embedded rat spleen tissue using anti-SHP1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Calcium-binding-protei
NBP1-33736
Western Blot: Calcium-binding-protein-P22 Antibody [NBP1-33736] - A. 50 ug mouse liver lysate/extract 12 % SDS-PAGE
Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human colon using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
PYK2/FAK2 Antibody
(SC06-15)
NBP2-67627
Western Blot: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of PYK2 on mouse brain lysates using anti-PYK2 antibody at 1:1000 dilution.
Immunocytochemistry/Immunofluorescence: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Staining PYK2 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X-100/PBS.
Immunohistochemistry-Paraffin: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of paraffin-embedded mouse kidney tissue using anti-PYK2 antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
TPPP/p25 Antibody
NBP2-34031
Western Blot: TPPP/p25 Antibody [NBP2-34031] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral cortex tissue.
Immunocytochemistry/Immunofluorescence: TPPP/p25 Antibody [NBP2-34031] - Staining of human cell line A549 shows localization to cytosol & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP2-34031] - Staining of human pancreas shows moderate cytoplasmic positivity in islets of Langerhans.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(33 Reviews)
(647 Publications)
Species: Hu
p63/TP73L Antibody
[Unconjugated]
AF1916
p63/TP73L was detected in immersion fixed paraffin-embedded sections of human breast using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
p63/TP73L was detected in immersion fixed SCC-25 human tongue carcinoma cell line using Goat Anti-Human p63/TP73L Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1916) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(4 Reviews)
(3 Publications)
Species: Hu
Applications: WB, IHC, ICC
p18INK4c/CDKN2C
Antibody (18P118 (DCS ...
NB120-3216
Western Blot: p18INK4c/CDKN2C Antibody (18P118 (same as DCS-118)) [NB120-3216] - Analysis of HeLa Cells.
Immunohistochemistry-Paraffin: p18INK4c/CDKN2C Antibody (18P118 (same as DCS-118)) [NB120-3216] - Human tonsil stained with p18 (NB120-3216) using peroxidase-conjugate and AEC chromogen. Note nuclear staining of cells.
Immunoprecipitation: p18INK4c/CDKN2C Antibody (18P118 (same as DCS-118)) [NB120-3216] - Analysis of native IP.
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
Reg1A Antibody
NBP2-13215
Reg1A Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Reg1A Antibody (NBP2-13215) (0)

There are no publications for Reg1A Antibody (NBP2-13215).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Reg1A Antibody (NBP2-13215) (0)

There are no reviews for Reg1A Antibody (NBP2-13215). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Reg1A Antibody (NBP2-13215). (Showing 1 - 1 of 1 FAQ).

  1. Please send me the detail of positive control which I can use in the IHC for the Reg1 alpha antibody with catalog number NBP2-13215.
    • Pancreas and Small intestine/Duodenum would be the best option as positive controls when performing IHC-P with Reg1 antibody with the catalog number NBP2-13215. Stomach can be another option if Pancreas or Small intestine/Duodenum is not available.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Reg1A Products

Bioinformatics Tool for Reg1A Antibody (NBP2-13215)

Discover related pathways, diseases and genes to Reg1A Antibody (NBP2-13215). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Reg1A Antibody (NBP2-13215)

Discover more about diseases related to Reg1A Antibody (NBP2-13215).
 

Pathways for Reg1A Antibody (NBP2-13215)

View related products by pathway.

PTMs for Reg1A Antibody (NBP2-13215)

Learn more about PTMs related to Reg1A Antibody (NBP2-13215).
 

Research Areas for Reg1A Antibody (NBP2-13215)

Find related products by research area.

Blogs on Reg1A

There are no specific blogs for Reg1A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Reg1A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol REG1A