Reg1A Antibody

Images

 
Western Blot: Reg1A Antibody [NBP2-13215] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215] - Staining of human liver shows no positivity in hepatocytes as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215] - Analysis in human pancreas and kidney tissues using NBP2-13215 antibody. Corresponding REG1A RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Reg1A Antibody [NBP2-13215] - Staining of human kidney shows no positivity in cells in tubules as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Reg1A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSV
Specificity
Specificity of human Reg1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
REG1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Reg1A Recombinant Protein Antigen (NBP2-13215PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Reg1A Antibody

  • ICRF
  • Islet cells regeneration factor
  • Islet of Langerhans regenerating protein
  • lithostathine-1-alpha
  • P19
  • pancreatic stone protein, secretory
  • Pancreatic thread protein
  • protein-X
  • PSP
  • PSPS
  • PSPS1
  • PTP
  • REG
  • Reg1A
  • REG-1-alpha
  • Regenerating islet-derived protein 1-alpha
  • Regenerating protein I alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
AF1366
Species: Hu
Applications: WB, Simple Western, IHC
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00027065-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-67321
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34031
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP2-13215
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Reg1A Antibody (NBP2-13215) (0)

There are no publications for Reg1A Antibody (NBP2-13215).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Reg1A Antibody (NBP2-13215) (0)

There are no reviews for Reg1A Antibody (NBP2-13215). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Reg1A Antibody (NBP2-13215). (Showing 1 - 1 of 1 FAQ).

  1. Please send me the detail of positive control which I can use in the IHC for the Reg1 alpha antibody with catalog number NBP2-13215.
    • Pancreas and Small intestine/Duodenum would be the best option as positive controls when performing IHC-P with Reg1 antibody with the catalog number NBP2-13215. Stomach can be another option if Pancreas or Small intestine/Duodenum is not available.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Reg1A Products

Bioinformatics Tool for Reg1A Antibody (NBP2-13215)

Discover related pathways, diseases and genes to Reg1A Antibody (NBP2-13215). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Reg1A Antibody (NBP2-13215)

Discover more about diseases related to Reg1A Antibody (NBP2-13215).
 

Pathways for Reg1A Antibody (NBP2-13215)

View related products by pathway.

PTMs for Reg1A Antibody (NBP2-13215)

Learn more about PTMs related to Reg1A Antibody (NBP2-13215).
 

Research Areas for Reg1A Antibody (NBP2-13215)

Find related products by research area.

Blogs on Reg1A

There are no specific blogs for Reg1A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Reg1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol REG1A