IL-37/IL-1F7 Antibody

Images

 
Immunohistochemistry-Paraffin: IL-37/IL-1F7 Antibody [NBP2-33712] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IL-37/IL-1F7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSE
Specificity
Specificity of human IL-37/IL-1F7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IL37
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IL-37/IL-1F7 Antibody

  • FIL1 zeta
  • FIL1
  • FIL1(ZETA)
  • FIL1ZFIL1 zeta
  • IL-1F7
  • IL-1F7IL-1 zeta
  • IL1H4IL1F7 (canonical product IL-1F7b)
  • IL-1H4IL-1F7b (IL-1H4, IL-1H, IL-1RP1)
  • IL-1RP1IL-1X protein
  • IL1RP1interleukin 1 family member 7
  • IL-1X
  • IL37
  • IL-37
  • interleukin 1 family, member 7 (zeta)
  • interleukin 1, zeta
  • interleukin-1 family member 7
  • Interleukin-1 homolog 4
  • interleukin-1 superfamily z
  • Interleukin-1 zeta
  • Interleukin-1-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
409-ML/CF
Species: Mu
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38780
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1916
Species: Hu
Applications: WB, IHC, ICC
NBP2-67117
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
AF4937
Species: Hu
Applications: WB, IHC

Publications for IL-37/IL-1F7 Antibody (NBP2-33712) (0)

There are no publications for IL-37/IL-1F7 Antibody (NBP2-33712).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-37/IL-1F7 Antibody (NBP2-33712) (0)

There are no reviews for IL-37/IL-1F7 Antibody (NBP2-33712). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IL-37/IL-1F7 Antibody (NBP2-33712) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IL-37/IL-1F7 Products

Bioinformatics Tool for IL-37/IL-1F7 Antibody (NBP2-33712)

Discover related pathways, diseases and genes to IL-37/IL-1F7 Antibody (NBP2-33712). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-37/IL-1F7 Antibody (NBP2-33712)

Discover more about diseases related to IL-37/IL-1F7 Antibody (NBP2-33712).
 

Pathways for IL-37/IL-1F7 Antibody (NBP2-33712)

View related products by pathway.

Research Areas for IL-37/IL-1F7 Antibody (NBP2-33712)

Find related products by research area.

Blogs on IL-37/IL-1F7

There are no specific blogs for IL-37/IL-1F7, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-37/IL-1F7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL37
Uniprot