IL-2 R beta Antibody - BSA Free

Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148] - Staining of human kidney shows no postivity in cells in tubules as expected.

Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148] - Analysis in human lymph node and kidney tissues. Corresponding IL-2 R beta RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148] - Staining of human colon shows strong cytoplasmic positivity in lymphocytes.

Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148] - Staining of human lymph node shows strong cytoplasmic positivity in lymphocytes.

Immunohistochemistry-Paraffin: IL-2 R beta Antibody [NBP2-34148] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IL-2 R beta Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IL2RB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  IL-2 R beta Protein (NBP2-34148PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IL-2 R beta Antibody - BSA Free

• CD122 antigen
• CD122
• high affinity IL-2 receptor beta subunit
• High affinity IL-2 receptor subunit beta
• IL-15 R beta
• IL-2 R beta
• IL-2 receptor subunit beta
• IL2R beta
• IL-2R subunit beta
• IL2RB
• IL-2Rb
• interleukin 15 receptor, beta
• interleukin 2 receptor, beta
• interleukin-2 receptor subunit beta
• P70-75
• p75

Background

The Interleukin 2 Receptor alpha and beta chains, together with the common gamma chain, constitute the high affinity IL2 receptor present on activated T and B cells, thymocyte subset, pre B cells and T regulatory cells. Homodimeric alpha chains result in low affinity receptor, while homodimeric beta chains produce a medium affinity receptor. Normally an integral membrane protein, soluble IL2 Receptor alpha has been isolated and determined to result from extracellular proteolysis. Alternately spliced IL2 Receptor alpha mRNAs have been isolated, but the significance of each is presently unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL2RB
• Uniprot:
  • P14784(Human)