IL-17RE Antibody (46N8G7) - BSA Free Summary
| Immunogen |
amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
IL17RE |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS |
| Preservative |
0.05% Sodium Azide |
| Concentration |
1.0 mg/ml |
| Purity |
Protein G purified |
Alternate Names for IL-17RE Antibody (46N8G7) - BSA Free
Background
Th17 cells are a subset of T helper cells with proinflammatory activities through the production of IL-17.IL-17RE is the receptor which recognizes the IL-17C, also known as IL-21, isoform of IL-17.IL-17C is thought to bind to IL-17RE - IL-17RA heterodimeric complexes and initiate signaling and activation cascades (1-4)IL-17RE signaling through IL17C also appears to act together with IL-22 in the induction of antibacterial peptides in colonic epithelial cells in host mucosal infection (3).IL-17RE defects lead to impaired IL-17C signaling and response to Clostridium rodentium, an analog of mucosal enteropathgenic infection of E coli in humans (1).The IL-17C isoform and the signaling pathway through IL-17RE has also been demonstrated in studies of psoriatic skin lesions (2)Undoubtedly, the different IL-17 isoforms and their particular receptors can be characterized with antibodies such as this one specific for IL-17RE to demonstrate specific and relative roles in mediating protective anti-host responses or inflammatory processes as part of the autoimmune disorders.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, ICFlow, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: AgAct, ICC, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, KO, Neut, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, Simple Western, WB
Species: Mu
Applications: Neut, WB
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC
Publications for IL-17RE Antibody (NBP2-27365) (0)
There are no publications for IL-17RE Antibody (NBP2-27365).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IL-17RE Antibody (NBP2-27365) (0)
There are no reviews for IL-17RE Antibody (NBP2-27365).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IL-17RE Antibody (NBP2-27365) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IL-17RE Products
Blogs on IL-17RE