IL-17RE Antibody (46N7E3)

Images

 
Western Blot: IL-17 RE Antibody (46N7E3) [NBP2-27368] - Analysis of IL-17RE using a partial recombinant protein (amino acids 97-199) probed with IL-17RE antibody at 5 ug/ml. Goat anti-mouse Ig HRP secondary antibody and ...read more
Immunohistochemistry-Paraffin: IL-17 RE Antibody (46N7E3) [NBP2-27368] - Analysis of IL-17RE in formalin-fixed, paraffin-embedded human kidney tissue using IL-17RE antibody at 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Flow, IHC, IHC-P
Clone
46N7E3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

IL-17RE Antibody (46N7E3) Summary

Immunogen
amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IL17RE
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 5-10ug/ml~
  • Flow Cytometry
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 10ug/ml~
Application Notes
Use in FLOW reported in scientific literature (PMID: 27534549).
Publications
Read Publication using
NBP2-27368 in the following applications:

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
0.2 ml PBS and 0.05% BSA
Preservative
0.05% Sodium Azide
Concentration
0.5 mg/ml
Purity
Protein G purified

Alternate Names for IL-17RE Antibody (46N7E3)

  • IL-17 RE
  • IL-17 receptor E
  • IL17RE
  • IL-17RE
  • Il25r
  • interleukin 17 receptor E

Background

Th17 cells are a subset of T helper cells with proinflammatory activities through the production of IL-17. IL-17RE is the receptor which recognizes the IL-17C, also known as IL-21, isoform of IL-17. IL-17C is thought to bind to IL-17RE - IL-17RA heterodimeric complexes and initiate signaling and activation cascades (1-4). IL-17RE signaling through IL17C also appears to act together with IL-22 in the induction of antibacterial peptides in colonic epithelial cells in host mucosal infection (3). IL-17RE defects lead to impaired IL-17C signaling and response to Clostridium rodentium, an analog of mucosal enteropathgenic infection of E coli in humans (1).The IL-17C isoform and the signaling pathway through IL-17RE has also been demonstrated in studies of psoriatic skin lesions (2). Undoubtedly, the different IL-17 isoforms and their particular receptors can be characterized with antibodies such as this one specific for IL-17RE to demonstrate specific and relative roles in mediating protective anti-host responses or inflammatory processes as part of the autoimmune disorders.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1234
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)
NBP2-27368
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-24503
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB342
Species: Hu
Applications: WB, AgAct
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
MAB195
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP2-14845
Species: Hu
Applications: WB, IHC, IHC-P
MAB177
Species: Hu
Applications: WB, Flow, CyTOF-ready, KO, Neut
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-67429
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56740
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P, IP
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
MAB5519
Species: Mu
Applications: Flow, CyTOF-ready, ICC
Supplier Logo

Publications for IL-17RE Antibody (NBP2-27368)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: Flow.


Filter By Application
Flow
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for IL-17RE Antibody (NBP2-27368) (0)

There are no reviews for IL-17RE Antibody (NBP2-27368). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-17RE Antibody (NBP2-27368) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Alexa Fluor 350 NBP2-27367AF350
Alexa Fluor 405 NBP2-27367AF405
Alexa Fluor 488 NBP2-27367AF488
Alexa Fluor 532 NBP2-27367AF532
Alexa Fluor 594 NBP2-27367AF594
Alexa Fluor 647 NBP2-27367AF647
Alexa Fluor 700 NBP2-27367AF700
Alexa Fluor 750 NBP2-27367AF750
Biotin NBP2-27367B
DyLight 350 NBP2-27367UV
DyLight 405 NBP2-27367V
DyLight 488 NBP2-27367G
DyLight 550 NBP2-27367R
DyLight 594 NBP2-27368DL594
DyLight 650 NBP2-27367C
DyLight 680 NBP2-27367FR
DyLight 755 NBP2-27367IR
FITC NBP2-27367F
HRP NBP2-27367H
Janelia Fluor 549 NBP2-27367JF549
Janelia Fluor 646 NBP2-27367JF646
PerCP NBP2-27367PCP

Additional IL-17RE Products

Bioinformatics Tool for IL-17RE Antibody (NBP2-27368)

Discover related pathways, diseases and genes to IL-17RE Antibody (NBP2-27368). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-17RE Antibody (NBP2-27368)

Discover more about diseases related to IL-17RE Antibody (NBP2-27368).
 

Pathways for IL-17RE Antibody (NBP2-27368)

View related products by pathway.

Blogs on IL-17RE

There are no specific blogs for IL-17RE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-17RE Antibody (46N7E3) and receive a gift card or discount.

Bioinformatics

Gene Symbol IL17RE