IL-17RE Antibody (46N7E3)

Western Blot: IL-17 RE Antibody (46N7E3) [NBP2-27368] - Analysis of IL-17RE using a partial recombinant protein (amino acids 97-199) probed with IL-17RE antibody at 5 ug/ml. Goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.

Immunohistochemistry-Paraffin: IL-17 RE Antibody (46N7E3) [NBP2-27368] - Analysis of IL-17RE in formalin-fixed, paraffin-embedded human kidney tissue using IL-17RE antibody at 10 ug/ml.

• Reactivity: Hu
• Applications: WB, Flow, IHC
• Clone: 46N7E3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Concentration: 0.5 mg/ml

IL-17RE Antibody (46N7E3) Summary

• Description: Novus Biologicals Mouse IL-17RE Antibody (46N7E3) (NBP2-27368) is a monoclonal antibody validated for use in IHC, WB and Flow. Anti-IL-17RE Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: IL17RE
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Flow Cytometry reported in scientific literature (PMID 27534549)
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 10ug/ml~
  • Western Blot 5-10ug/ml~

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS and 0.05% BSA
• Preservative: 0.05% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Protein G purified

Alternate Names for IL-17RE Antibody (46N7E3)

• IL-17 RE
• IL-17 receptor E
• IL17RE
• IL-17RE
• Il25r
• interleukin 17 receptor E

Background

Th17 cells are a subset of T helper cells with proinflammatory activities through the production of IL-17. IL-17RE is the receptor which recognizes the IL-17C, also known as IL-21, isoform of IL-17. IL-17C is thought to bind to IL-17RE - IL-17RA heterodimeric complexes and initiate signaling and activation cascades (1-4). IL-17RE signaling through IL17C also appears to act together with IL-22 in the induction of antibacterial peptides in colonic epithelial cells in host mucosal infection (3). IL-17RE defects lead to impaired IL-17C signaling and response to Clostridium rodentium, an analog of mucosal enteropathgenic infection of E coli in humans (1).The IL-17C isoform and the signaling pathway through IL-17RE has also been demonstrated in studies of psoriatic skin lesions (2). Undoubtedly, the different IL-17 isoforms and their particular receptors can be characterized with antibodies such as this one specific for IL-17RE to demonstrate specific and relative roles in mediating protective anti-host responses or inflammatory processes as part of the autoimmune disorders.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IL-17RE Antibody (NBP2-27368)(1)

Publication using NBP2-27368

• Liu R, Lauridsen HM, Amezquita RA et al. IL-17 Promotes Neutrophil-Mediated Immunity by Activating Microvascular Pericytes and Not Endothelium. J. Immunol. 2016-08-17 [PMID: 27534549] (FLOW, Human)

Bioinformatics

• Gene Symbol: IL17RE