IL-17RE Antibody (46N8G7) - Azide and BSA Free

Western Blot: IL-17 RE Antibody (46N8G7) - Azide Free [NBP2-27366] - Analysis of IL-17RE using a partial recombinant protein (amino acids 97-199) probed with NBP2-27366 antibody at 5 ug/ml. Goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.

• Reactivity: Hu
• Applications: WB
• Clone: 46N8G7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

IL-17RE Antibody (46N8G7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse IL-17RE Antibody (46N8G7) - Azide and BSA Free (NBP2-27365) is a monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: IL17RE
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot 5-10ug/ml~

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS
• Preservative: No Preservative
• Purity: Protein G purified

Alternate Names for IL-17RE Antibody (46N8G7) - Azide and BSA Free

• IL-17 RE
• IL-17 receptor E
• IL17RE
• IL-17RE
• Il25r
• interleukin 17 receptor E

Background

Th17 cells are a subset of T helper cells with proinflammatory activities through the production of IL-17.IL-17RE is the receptor which recognizes the IL-17C, also known as IL-21, isoform of IL-17. IL-17C is thought to bind to IL-17RE - IL-17RA heterodimeric complexes and initiate signaling and activation cascades (1-4). IL-17RE signaling through IL17C also appears to act together with IL-22 in the induction of antibacterial peptides in colonic epithelial cells in host mucosal infection (3). IL-17RE defects lead to impaired IL-17C signaling and response to Clostridium rodentium, an analog of mucosal enteropathgenic infection of E coli in humans (1).The IL-17C isoform and the signaling pathway through IL-17RE has also been demonstrated in studies of psoriatic skin lesions (2). Undoubtedly, the different IL-17 isoforms and their particular receptors can be characterized with antibodies such as this one specific for IL-17RE to demonstrate specific and relative roles in mediating protective anti-host responses or inflammatory processes as part of the autoimmune disorders.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IL17RE