IKEPP Antibody

Images

 
Immunohistochemistry-Paraffin: IKEPP Antibody [NBP3-17195] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IKEPP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSTLSGHRVCQAHGEPVLGLCPLLPLFCCPPHPPDPWSLERPRFCLLSKEEGKSFGFHLQQELGRAGHVVCRVDPGTSAQRQGLQEGDRILAVNNDV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDZD3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for IKEPP Antibody

  • FLJ22756
  • IKEPPPDZK2
  • intestinal and kidney enriched PDZ protein
  • Intestinal and kidney-enriched PDZ protein
  • Na(+)/H(+) exchange regulatory cofactor NHE-RF4
  • Na/Pi cotransporter C-terminal-associated protein 2
  • naPi-Cap2
  • Natrium-phosphate cotransporter IIa C-terminal-associated protein 2
  • NHERF4
  • NHERF-4
  • PDZ domain containing 2
  • PDZ domain containing 3
  • PDZ domain-containing protein 2
  • PDZ domain-containing protein 3
  • Sodium-hydrogen exchanger regulatory factor 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-149
Species: Bv, Hu, Mu, Rt(-)
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-2450
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NB300-536
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
MAB25031
Species: Hu
Applications: IHC, IP, WB
MAB7670
Species: Hu
Applications: ICC, WB
NB110-81529
Species: Hu, Mu, Ma-Op, Po, Pm, Rb, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IP, KD, KO, Simple Western, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
H00006583-A01
Species: Ca, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-WhMt, IHC, IHC-Fr, WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-81788
Species: Hu
Applications: IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-93654
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-75618
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-84450
Species: Hu, Mu
Applications: IHC-WhMt, IHC, IHC-P, WB
NBP1-74138
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86665
Species: Hu
Applications: IHC, IHC-P, WB
MAB7665
Species: Hu
Applications: IHC, WB
NBP3-17195
Species: Hu
Applications: IHC, IHC-P

Publications for IKEPP Antibody (NBP3-17195) (0)

There are no publications for IKEPP Antibody (NBP3-17195).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IKEPP Antibody (NBP3-17195) (0)

There are no reviews for IKEPP Antibody (NBP3-17195). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IKEPP Antibody (NBP3-17195) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IKEPP Products

Bioinformatics Tool for IKEPP Antibody (NBP3-17195)

Discover related pathways, diseases and genes to IKEPP Antibody (NBP3-17195). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for IKEPP Antibody (NBP3-17195)

Find related products by research area.

Blogs on IKEPP

There are no specific blogs for IKEPP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IKEPP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDZD3