Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788] - Staining of human liver shows no positivity in hepatocyes as expected.
Novus Biologicals Rabbit GUCY2C Antibody - BSA Free (NBP1-81788) is a polyclonal antibody validated for use in IHC. Anti-GUCY2C Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GUCY2C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Receptor for the E.coli heat-stable enterotoxin (E.coli enterotoxin markedly stimulates the accumulation of cGMP in mammalian cells expressing GC-C). Also activated by the endogenous peptide guanylin.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for GUCY2C Antibody (NBP1-81788). (Showing 1 - 2 of 2 FAQ).
Does this human Gucy2c antibody cross react with mouse?
Based on the immunogen sequence used the antibody has about 79% homology with mouse. We typically do not recommend anything that is below 85% for testing as there is not as great of a chance it will work. Especially with this one where their are lots of glycosylation sites and the amino acids that differ are spread out. Since it is polyclonal though there may be a chance since it isn't binding just one location, although the affinity may be lower so concentration might need to be increased. We have not yet tested in mouse, so it will be up to your discretion if you wish to try this one out, or not as we cannot guarantee it. For future reference if you wish to know is something is predicted not to work in a particular species or application we will list it with a (-) next to it. Such as Mu (-). If it has not been tested we will leave it blank.
Does GUCY2C Antibody 0.1 ml have any potential IP issues?
It looks like by IP you meant Intellectual Property, and NO, we do not know of any IP issues with this product.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our GUCY2C Antibody - BSA Free and receive a gift card or discount.