GUCY2C Antibody

Images

 
Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GUCY2C Antibody [NBP1-81788] - Staining of human liver shows no positivity in hepatocyes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GUCY2C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EVRGETYLKGRGNETTYWLTGMKDQKFNLPTPPTVENQQRLQAEFSDMIANSLQKRQAAGIRSQKPRRVASYKKGTLEYLQLNTTD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GUCY2C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GUCY2C Protein (NBP1-81788PEP)
Publications
Read Publication using
NBP1-81788 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GUCY2C Antibody

  • DIAR6
  • EC 4.6.1
  • GCC
  • GC-C
  • guanylate cyclase 2C (heat stable enterotoxin receptor)
  • Guanylate Cyclase C
  • Guanylyl Cyclase C
  • GUC2C
  • GUC2CEC 4.6.1.2
  • GUCY2C
  • heat-stable enterotoxin receptor
  • hSTAR
  • Intestinal guanylate cyclase
  • MUCIL
  • STA Receptor
  • StAR
  • STARSTA receptor

Background

Receptor for the E.coli heat-stable enterotoxin (E.coli enterotoxin markedly stimulates the accumulation of cGMP in mammalian cells expressing GC-C). Also activated by the endogenous peptide guanylin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GUCY2C Antibody (NBP1-81788)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GUCY2C Antibody (NBP1-81788) (0)

There are no reviews for GUCY2C Antibody (NBP1-81788). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GUCY2C Antibody (NBP1-81788). (Showing 1 - 2 of 2 FAQ).

  1. Does this human Gucy2c antibody cross react with mouse?
    • Based on the immunogen sequence used the antibody has about 79% homology with mouse. We typically do not recommend anything that is below 85% for testing as there is not as great of a chance it will work. Especially with this one where their are lots of glycosylation sites and the amino acids that differ are spread out. Since it is polyclonal though there may be a chance since it isn't binding just one location, although the affinity may be lower so concentration might need to be increased. We have not yet tested in mouse, so it will be up to your discretion if you wish to try this one out, or not as we cannot guarantee it. For future reference if you wish to know is something is predicted not to work in a particular species or application we will list it with a (-) next to it. Such as Mu (-). If it has not been tested we will leave it blank.
  2. Does GUCY2C Antibody 0.1 ml have any potential IP issues?
    • It looks like by IP you meant Intellectual Property, and NO, we do not know of any IP issues with this product.

Secondary Antibodies

 

Isotype Controls

Additional GUCY2C Products

Research Areas for GUCY2C Antibody (NBP1-81788)

Find related products by research area.

Blogs on GUCY2C

There are no specific blogs for GUCY2C, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GUCY2C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GUCY2C