IKEPP Antibody - BSA Free

Western Blot: IKEPP Antibody [NBP2-84088] - Host: Rabbit. Target Name: PDZD3. Sample Type: HepG2 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

IKEPP Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human IKEPP. Peptide sequence: APLAEGWALPTKPRCLHLEKGPQGFGFLLREEKGLDGRPGQFLWEVDPGL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NHERF4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for IKEPP Antibody - BSA Free

• FLJ22756
• IKEPPPDZK2
• intestinal and kidney enriched PDZ protein
• Intestinal and kidney-enriched PDZ protein
• Na(+)/H(+) exchange regulatory cofactor NHE-RF4
• Na/Pi cotransporter C-terminal-associated protein 2
• naPi-Cap2
• Natrium-phosphate cotransporter IIa C-terminal-associated protein 2
• NHERF4
• NHERF-4
• PDZ domain containing 2
• PDZ domain containing 3
• PDZ domain-containing protein 2
• PDZ domain-containing protein 3
• Sodium-hydrogen exchanger regulatory factor 4

Background

IKEPP, also known as PDZD3, associates with GUCY2C to act as a regulatory protein and negatively modulates the heat-stable enterotoxin-mediated activation of GUCY2C. Specifically, IKEPP regulates the amount of cGMP produced following receptor stimulation. IKEPP has also been found to stimulate SLC9A3 activity in the presence of elevated calcium ions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NHERF4