IGSF6/DORA Antibody

Images

 
Immunohistochemistry-Paraffin: IGSF6/DORA Antibody [NBP1-84061] - DORA Antibody [NBP1-84061] - Staining of human lymph node shows strong positivity in a subset of cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IGSF6/DORA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VTIKCTFSATGCPSEQPTCLWFRYGAHQPENLCLDGCKSEADKFTVREALKENQVSLTVNRVTSNDSAIYICGIAFPSVPEARAKQTGGGTTLVVREIKLLSK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGSF6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IGSF6/DORA Recombinant Protein Antigen (NBP1-84061PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IGSF6/DORA Antibody

  • DORA
  • DORAdown-regulated by activation (immunoglobulin superfamily)
  • IGSF6
  • immunoglobulin superfamily member 6
  • immunoglobulin superfamily, member 6
  • Protein DORA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
AF4409
Species: Mu
Applications: WB
MAB763
Species: Hu, Mu, Rt
Applications: IHC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-89479
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-98474
Species: Hu
Applications: WB
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-69668
Species: Hu
Applications: WB

Publications for IGSF6/DORA Antibody (NBP1-84061) (0)

There are no publications for IGSF6/DORA Antibody (NBP1-84061).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGSF6/DORA Antibody (NBP1-84061) (0)

There are no reviews for IGSF6/DORA Antibody (NBP1-84061). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IGSF6/DORA Antibody (NBP1-84061) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGSF6/DORA Products

Bioinformatics Tool for IGSF6/DORA Antibody (NBP1-84061)

Discover related pathways, diseases and genes to IGSF6/DORA Antibody (NBP1-84061). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGSF6/DORA Antibody (NBP1-84061)

Discover more about diseases related to IGSF6/DORA Antibody (NBP1-84061).
 

Pathways for IGSF6/DORA Antibody (NBP1-84061)

View related products by pathway.

PTMs for IGSF6/DORA Antibody (NBP1-84061)

Learn more about PTMs related to IGSF6/DORA Antibody (NBP1-84061).

Blogs on IGSF6/DORA

There are no specific blogs for IGSF6/DORA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IGSF6/DORA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IGSF6
Entrez