IGFBP-1 Antibody


Immunocytochemistry/ Immunofluorescence: IGFBP-1 Antibody [NBP2-33475] - Staining of human cell line Hep G2 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475] - Staining of human kidney.
Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475] - Staining in human placenta and prostate tissues using anti-IGFBP1 antibody. Corresponding IGFBP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475] - Staining of human colon, kidney, placenta and testis using Anti-IGFBP1 antibody NBP2-33475 (A) shows similar protein distribution across tissues to ...read more
Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475] - Staining of human testis.
Immunohistochemistry-Paraffin: IGFBP-1 Antibody [NBP2-33475] - Staining of human colon.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

IGFBP-1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: QQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGS
Specificity of human IGFBP-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IGFBP-1 Protein (NBP2-33475PEP)
Read Publication using NBP2-33475.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24743550)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for IGFBP-1 Antibody

  • alpha-pregnancy-associated endometrial globulin
  • amniotic fluid binding protein
  • binding protein-25
  • binding protein-26
  • binding protein-28
  • growth hormone independent-binding protein
  • hIGFBP-1
  • IBP1
  • IBP-1
  • IGF-binding protein 1
  • IGFBP1
  • IGFBP-1
  • IGF-BP25
  • insulin-like growth factor binding protein 1
  • insulin-like growth factor-binding protein 1
  • Placental protein 12
  • PP12AFBP


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, Simple Western, Neut
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, Flow, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for IGFBP-1 Antibody (NBP2-33475)(1)

Reviews for IGFBP-1 Antibody (NBP2-33475) (0)

There are no reviews for IGFBP-1 Antibody (NBP2-33475). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for IGFBP-1 Antibody (NBP2-33475) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for IGFBP-1 Antibody (NBP2-33475)

Discover related pathways, diseases and genes to IGFBP-1 Antibody (NBP2-33475). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGFBP-1 Antibody (NBP2-33475)

Discover more about diseases related to IGFBP-1 Antibody (NBP2-33475).

Pathways for IGFBP-1 Antibody (NBP2-33475)

View related products by pathway.

PTMs for IGFBP-1 Antibody (NBP2-33475)

Learn more about PTMs related to IGFBP-1 Antibody (NBP2-33475).

Blogs on IGFBP-1

There are no specific blogs for IGFBP-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our IGFBP-1 Antibody and receive a gift card or discount.


Gene Symbol IGFBP1