IGFBP-4 Antibody


Western Blot: IGFBP-4 Antibody [NBP1-80549] - Host: Mouse. Target Name: IGFBP4. Sample Tissue: Mouse Brain. Antibody Dilution: 1ug/ml
Immunocytochemistry/ Immunofluorescence: IGFBP-4 Antibody [NBP1-80549] - Rac1 regulates vesicular exocytosis in decidual cells by controlling Rab27b. Secretions by decidual cells are reduced in the conditioned media of ...read more
Immunohistochemistry-Paraffin: IGFBP-4 Antibody [NBP1-80549] - Human Prostate Tissue, 5.0ug/ml.
Western Blot: IGFBP-4 Antibody [NBP1-80549] - Human Fetal Brain Lysate, concentration 1 ug/ml.
Western Blot: IGFBP-4 Antibody [NBP1-80549] - Host: Rabbit. Target Name: IGFBP4. Sample Tissue: Human MDA-MB-435s Whole Cell. Antibody Dilution: 1ug/ml
Immunocytochemistry/ Immunofluorescence: IGFBP-4 Antibody [NBP1-80549] - Mouse uterus stained with at a dilution of 1:1000. HIER is applied using citrate buffer pH6. Image from verified customer review.

Product Details

Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gt, Gp, Rb, ShSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr, IHC-P

Order Details

IGFBP-4 Antibody Summary

Synthetic peptide directed towards the middle region of human IGFBP4. Peptide sequence RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV.
Predicted Species
Rat (100%), Goat (100%), Canine (100%), Sheep (100%), Equine (100%), Bovine (100%), Guinea Pig (93%), Rabbit (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against IGFBP4 and was validated on Western blot. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID: 26305333).
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
NBP1-80549 in the following applications:

Read Publication using
NBP1-80549 in the following applications:

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IGFBP-4 Antibody

  • BP-4
  • HT29-IGFBP
  • IBP4insulin-like growth factor-binding protein 4
  • IGF-binding protein 4
  • IGFBP4
  • IGFBP-4
  • IGFBP-4IBP-4
  • insulin-like growth factor binding protein 4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for IGFBP-4 Antibody (NBP1-80549)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-Fr.

Filter By Application
All Applications
Filter By Species
All Species

Review for IGFBP-4 Antibody (NBP1-80549) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: mouse.

Reviews using NBP1-80549:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry/Immunofluorescence IGFBP-4 NBP1-80549
reviewed by:
ICC/IF mouse 11/16/2016


Sample Testedmouse uterus

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IGFBP-4 Antibody (NBP1-80549) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional IGFBP-4 Products

Bioinformatics Tool for IGFBP-4 Antibody (NBP1-80549)

Discover related pathways, diseases and genes to IGFBP-4 Antibody (NBP1-80549). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGFBP-4 Antibody (NBP1-80549)

Discover more about diseases related to IGFBP-4 Antibody (NBP1-80549).

Pathways for IGFBP-4 Antibody (NBP1-80549)

View related products by pathway.

PTMs for IGFBP-4 Antibody (NBP1-80549)

Learn more about PTMs related to IGFBP-4 Antibody (NBP1-80549).

Blogs on IGFBP-4

There are no specific blogs for IGFBP-4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: ICC/IF
Species: mouse


Gene Symbol IGFBP4