IGFBP-4 Antibody

Images

 
Western Blot: IGFBP-4 Antibody [NBP1-80549] - Human Fetal Brain Lysate, concentration 1 ug/ml.
Immunohistochemistry-Paraffin: IGFBP-4 Antibody [NBP1-80549] - Human Prostate Tissue, 5.0ug/ml.
Immunofluorescence: IGFBP-4 Antibody [NBP1-80549] - Mouse uterus stained with IGFBP-4 Antibody at a dilution of 1:1000. HIER is applied using citrate buffer pH6. Image from verified customer review.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IGFBP-4 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human IGFBP4. Peptide sequence RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IGFBP4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against IGFBP4 and was validated on Western blot.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
using
NBP1-80549 in the following applications:

Publications
Read Publication using
NBP1-80549 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for IGFBP-4 Antibody

  • BP-4
  • HT29-IGFBP
  • IBP4insulin-like growth factor-binding protein 4
  • IGF-binding protein 4
  • IGFBP4
  • IGFBP-4
  • IGFBP-4IBP-4
  • insulin-like growth factor binding protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF875
Species: Hu
Applications: WB, IHC
AF674
Species: Hu
Applications: WB, Simple Western, Neut
AF776
Species: Mu
Applications: WB, IHC
AF2487
Species: Hu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-87052
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-35213
Species: Hu
AF1360
Species: Mu
Applications: WB, IHC

Publications for IGFBP-4 Antibody (NBP1-80549)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-Fr.


Filter By Application
IHC-Fr
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for IGFBP-4 Antibody (NBP1-80549) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: mouse.
We have 1 review tested in 1 application: ICC/IF.

Reviews using NBP1-80549:
Filter by Applications
ICC/IF
(1)
All Applications
Filter by Species
mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry/Immunofluorescence IGFBP-4 NBP1-80549
Enlarge
reviewed by:
Anonymous
ICC/IF mouse 11/16/2016
View

Summary

ApplicationImmunocytochemistry/Immunofluorescence
Sample Testedmouse uterus
Speciesmouse
LotQC55017

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for IGFBP-4 Antibody (NBP1-80549) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IGFBP-4 Products

Bioinformatics Tool for IGFBP-4 Antibody (NBP1-80549)

Discover related pathways, diseases and genes to IGFBP-4 Antibody (NBP1-80549). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGFBP-4 Antibody (NBP1-80549)

Discover more about diseases related to IGFBP-4 Antibody (NBP1-80549).
 

Pathways for IGFBP-4 Antibody (NBP1-80549)

View related products by pathway.

PTMs for IGFBP-4 Antibody (NBP1-80549)

Learn more about PTMs related to IGFBP-4 Antibody (NBP1-80549).

Blogs on IGFBP-4

There are no specific blogs for IGFBP-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
11/16/2016
Application: ICC/IF
Species: mouse

Bioinformatics

Gene Symbol IGFBP4
Entrez
Uniprot