![Immunocytochemistry/Immunofluorescence: IFIT1 Antibody [NBP2-33751] - Immunofluorescent staining of human cell line HeLa shows localization to cytosol.](http://images.novusbio.com/fullsize/IFIT1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33751-img0005.jpg "Immunocytochemistry/Immunofluorescence: IFIT1 Antibody [NBP2-33751] - Immunofluorescent staining of human cell line HeLa shows localization to cytosol.")
| Reactivity | Hu, PmSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit IFIT1 Antibody - BSA Free (NBP2-33751) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-IFIT1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IFIT1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. IHC-P reported by a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-33751 | Applications | Species |
|---|---|---|
| John SP, Sun J, Carlson RJ et al. IFIT1 Exerts Opposing Regulatory Effects on the Inflammatory and Interferon Gene Programs in LPS-Activated Human Macrophages. Cell Rep. 2018-10-02 [PMID: 30282041] (Human) | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Maria Cecilia Marcondes |
IHC-P | Other | 06/01/2015 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for IFIT1 Antibody (NBP2-33751)Find related products by research area.
|
|
STING in Innate Immunity and Cancer: What’s the Buzz About? STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Maria Cecilia Marcondes 06/01/2015 |
||
| Application: | IHC-P | |
| Species: | Other |
![Immunohistochemistry-Paraffin: IFIT1 Antibody [NBP2-33751] - Staining in macaque brain tissue. Image from a verified customer review.](http://images.novusbio.com/fullsize/IFIT1-Antibody-Immunohistochemistry-Paraffin-NBP2-33751-img0006.jpg "Immunohistochemistry-Paraffin: IFIT1 Antibody [NBP2-33751] - Staining in macaque brain tissue. Image from a verified customer review.")
![Immunohistochemistry-Paraffin: IFIT1 Antibody [NBP2-33751] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.](http://images.novusbio.com/fullsize/IFIT1-Antibody-Immunohistochemistry-Paraffin-NBP2-33751-img0003.jpg "Immunohistochemistry-Paraffin: IFIT1 Antibody [NBP2-33751] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.")
![Immunocytochemistry Lck [p Tyr394] Antibody (755103)](https://images.novusbio.com/images2/Lck_MAB7500_Immunocytochemistry_12319.jpg)
![Western Blot Lck [p Tyr394] Antibody (755103)](https://images.novusbio.com/images2/Lck_MAB7500_Western_Blot_12455.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![ISG15/UCRP [7-Amino-4-Methyl Coumarin]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "ISG15/UCRP [7-Amino-4-Methyl Coumarin]")
![Western Blot Lyn Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyn_AF3206_Western_Blot_5256.jpg)
![Simple Western Lyn Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyn_AF3206_Simple_Western_21252.jpg)
![Immunocytochemistry Lyn Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyn_AF3206_Immunocytochemistry_9784.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/DATA_CXCL10_DIP100_ELISA_723.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/DATA_CXCL10_DIP100_ELISA_724.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/CXCL10_DIP100_ELISA_121.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
