| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IFIT1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. IHC-P reported by a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-33751 | Applications | Species |
|---|---|---|
| John SP, Sun J, Carlson RJ et al. IFIT1 Exerts Opposing Regulatory Effects on the Inflammatory and Interferon Gene Programs in LPS-Activated Human Macrophages. Cell Rep. 2018-10-02 [PMID: 30282041] (Human) | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Maria Cecilia Marcondes |
IHC-P | Other | 06/01/2015 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for IFIT1 Antibody (NBP2-33751)Find related products by research area.
|
|
STING in Innate Immunity and Cancer: What’s the Buzz About? STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Maria Cecilia Marcondes 06/01/2015 |
||
| Application: | IHC-P | |
| Species: | Other |