ZAP70 Antibody

Images

 
Western Blot: ZAP70 Antibody [NBP1-87000] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: ...read more
Immunohistochemistry-Paraffin: ZAP70 Antibody [NBP1-87000] - Staining of human appendix shows strong nuclear positivity in lymphoid tissue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZAP70 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARITSPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZAP70
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Immunoprecipitation 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZAP70 Protein (NBP1-87000PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZAP70 Antibody

  • 70 kDa zeta-associated protein
  • EC 2.7.10
  • EC 2.7.10.2
  • mrtle
  • mur
  • SRK
  • SRKFLJ17679
  • STD
  • STDFLJ17670
  • Syk-related tyrosine kinase
  • tyrosine-protein kinase ZAP-70
  • TZK
  • ZAP70
  • ZAP-70
  • zeta-chain (TCR) associated protein kinase (70 kD)
  • zeta-chain (TCR) associated protein kinase 70kDa
  • zeta-chain associated protein kinase, 70kD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7500
Species: Hu
Applications: WB, ICC
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-46177
Species: Hu
Applications: IP (-), WB, IHC, IHC-P
NBP1-92440
Species: Hu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB7474
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-87000
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for ZAP70 Antibody (NBP1-87000) (0)

There are no publications for ZAP70 Antibody (NBP1-87000).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZAP70 Antibody (NBP1-87000) (0)

There are no reviews for ZAP70 Antibody (NBP1-87000). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZAP70 Antibody (NBP1-87000) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZAP70 Products

Bioinformatics Tool for ZAP70 Antibody (NBP1-87000)

Discover related pathways, diseases and genes to ZAP70 Antibody (NBP1-87000). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZAP70 Antibody (NBP1-87000)

Discover more about diseases related to ZAP70 Antibody (NBP1-87000).
 

Pathways for ZAP70 Antibody (NBP1-87000)

View related products by pathway.

PTMs for ZAP70 Antibody (NBP1-87000)

Learn more about PTMs related to ZAP70 Antibody (NBP1-87000).
 

Research Areas for ZAP70 Antibody (NBP1-87000)

Find related products by research area.

Blogs on ZAP70

There are no specific blogs for ZAP70, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZAP70 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZAP70
Entrez