ICEBERG Antibody

Images

 
Immunohistochemistry: ICEBERG Antibody [NBP2-48688] - Staining of human kidney shows strong cytoplasmic positivity in distal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ICEBERG Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH
Specificity
Specificity of human ICEBERG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CARD18
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ICEBERG Recombinant Protein Antigen (NBP2-48688PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ICEBERG Antibody

  • caspase recruitment domain family, member 18
  • Caspase-1 inhibitor Iceberg
  • ICEBERG caspase-1 inhibitor
  • ICEBERGcaspase recruitment domain-containing protein 18
  • pseudo-ICE
  • UNQ5804

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008767-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NBP2-22737
Species: Hu
NBP1-84556
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-856
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP2-44743
Species: Hu, Pm, Pm, Bv(-), Ca(-), Po(-), Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
NB100-56181
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-89827
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31807
Species: Hu
Applications: IHC, IHC-P
MAB197
Species: Hu
Applications: Flow, IHC, CyTOF-reported, ICC, Neut
NBP2-75656
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Ma-Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single-Cell Western
NBP1-91697
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56080
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-48688
Species: Hu
Applications: IHC, IHC-P

Publications for ICEBERG Antibody (NBP2-48688) (0)

There are no publications for ICEBERG Antibody (NBP2-48688).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ICEBERG Antibody (NBP2-48688) (0)

There are no reviews for ICEBERG Antibody (NBP2-48688). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ICEBERG Antibody (NBP2-48688) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ICEBERG Products

Bioinformatics Tool for ICEBERG Antibody (NBP2-48688)

Discover related pathways, diseases and genes to ICEBERG Antibody (NBP2-48688). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ICEBERG Antibody (NBP2-48688)

Discover more about diseases related to ICEBERG Antibody (NBP2-48688).

Research Areas for ICEBERG Antibody (NBP2-48688)

Find related products by research area.

Blogs on ICEBERG

There are no specific blogs for ICEBERG, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ICEBERG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CARD18