ICEBERG Antibody - BSA Free

Immunohistochemistry: ICEBERG Antibody [NBP2-48688] - Staining of human kidney shows strong cytoplasmic positivity in distal tubules.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ICEBERG Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ICEBERG Antibody - BSA Free (NBP2-48688) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CARD18
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ICEBERG Recombinant Protein Antigen (NBP2-48688PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ICEBERG Antibody - BSA Free

• caspase recruitment domain family, member 18
• Caspase-1 inhibitor Iceberg
• ICEBERG caspase-1 inhibitor
• ICEBERGcaspase recruitment domain-containing protein 18
• pseudo-ICE
• UNQ5804

Background

ICEBERG, also known as Caspase recruitment domain-containing protein 18, is a 90 amino acid protein that is 10 kDa, most often expressed in the heart and placenta, down-regulates the release of IL1B, and by interacting with caspase-1 and preventing its association with RIP2 inhibits the generation of IL-1-beta. This protein is being studied for its involvement in chronic lymphocytic leukemia. The ICEBERG protein has been linked to the NOD-like receptor signaling pathway where it interacts with CASP1, CARD8, CARD16, and CARD17.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CARD18