ICEBERG Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit ICEBERG Antibody - BSA Free (NBP2-48688) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: DTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CARD18 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ICEBERG Antibody - BSA Free
Background
ICEBERG, also known as Caspase recruitment domain-containing protein 18, is a 90 amino acid protein that is 10 kDa, most often expressed in the heart and placenta, down-regulates the release of IL1B, and by interacting with caspase-1 and preventing its association with RIP2 inhibits the generation of IL-1-beta. This protein is being studied for its involvement in chronic lymphocytic leukemia. The ICEBERG protein has been linked to the NOD-like receptor signaling pathway where it interacts with CASP1, CARD8, CARD16, and CARD17.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Hu, Mu
Applications: Flow, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-reported, Dual ISH-IHC, Flow, ICC, IHC, Neut
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC
Publications for ICEBERG Antibody (NBP2-48688) (0)
There are no publications for ICEBERG Antibody (NBP2-48688).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ICEBERG Antibody (NBP2-48688) (0)
There are no reviews for ICEBERG Antibody (NBP2-48688).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for ICEBERG Antibody (NBP2-48688) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ICEBERG Products
Research Areas for ICEBERG Antibody (NBP2-48688)
Find related products by research area.
|
Blogs on ICEBERG