Fc epsilon RI beta/MS4A2 Antibody

Images

 
Immunohistochemistry-Paraffin: Fc epsilon RI beta/MS4A2 Antibody [NBP2-31807] - Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fc epsilon RI beta/MS4A2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPID
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MS4A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Fc epsilon RI beta/MS4A2 Protein (NBP2-31807PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Fc epsilon RI beta/MS4A2 Antibody

  • APY
  • ATOPY
  • Fc epsilon receptor I beta-chain
  • Fc epsilon RI beta
  • Fc epsilonRIb
  • FCER1B
  • FCER1BIGEL
  • FCERI
  • High affinity immunoglobulin epsilon receptor beta-subunit (FcERI) (IgE Fcreceptor, beta-subunit) (Fc epsilon receptor I beta-chain)
  • high affinity immunoglobulin epsilon receptor subunit beta
  • IgE Fc receptor subunit beta
  • IgE responsiveness (atopic)
  • IGEL
  • IGER
  • IGHER
  • immunoglobulin E receptor, high affinity, beta polypeptide
  • Membrane-spanning 4-domains subfamily A member 2
  • membrane-spanning 4-domains, subfamily A, member 2 (Fc fragment of IgE, highaffinity I, receptor for; beta polypeptide)
  • MS4A1
  • MS4A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-470
Species: Hu
Applications: ELISA, Flow
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AB-230-NA
Species: Hu
Applications: WB, Neut
NB100-63269
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IP
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86543
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-69315
Species: Hu
Applications: WB

Publications for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807) (0)

There are no publications for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807) (0)

There are no reviews for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fc epsilon RI beta/MS4A2 Products

Bioinformatics Tool for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807)

Discover related pathways, diseases and genes to Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807)

Discover more about diseases related to Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807).
 

Pathways for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807)

View related products by pathway.

PTMs for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807)

Learn more about PTMs related to Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807).
 

Research Areas for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807)

Find related products by research area.

Blogs on Fc epsilon RI beta/MS4A2

There are no specific blogs for Fc epsilon RI beta/MS4A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fc epsilon RI beta/MS4A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MS4A2
Entrez
Uniprot