Fc epsilon RI beta/MS4A2 Antibody


Immunohistochemistry-Paraffin: Fc epsilon RI beta/MS4A2 Antibody [NBP2-31807] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Fc epsilon RI beta/MS4A2 Antibody [NBP2-31807] - Staining of human gallbladder shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Fc epsilon RI beta/MS4A2 Antibody [NBP2-31807] - Staining in human gallbladder and pancreas tissues using anti-MS4A2 antibody. Corresponding MS4A2 RNA-seq ...read more

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Fc epsilon RI beta/MS4A2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: EELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPID
Specificity of human Fc epsilon RI beta/MS4A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Fc epsilon RI beta/MS4A2 Protein (NBP2-31807PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Fc epsilon RI beta/MS4A2 Antibody

  • APY
  • Fc epsilon receptor I beta-chain
  • Fc epsilon RI beta
  • Fc epsilonRIb
  • FCER1B
  • High affinity immunoglobulin epsilon receptor beta-subunit (FcERI) (IgE Fcreceptor, beta-subunit) (Fc epsilon receptor I beta-chain)
  • high affinity immunoglobulin epsilon receptor subunit beta
  • IgE Fc receptor subunit beta
  • IgE responsiveness (atopic)
  • IGEL
  • IGER
  • immunoglobulin E receptor, high affinity, beta polypeptide
  • Membrane-spanning 4-domains subfamily A member 2
  • membrane-spanning 4-domains, subfamily A, member 2 (Fc fragment of IgE, highaffinity I, receptor for; beta polypeptide)
  • MS4A1
  • MS4A2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, IHC-Fr, IHC-P, Flow-CS, Flow-IC, IF
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Neut
Species: Hu
Applications: Flow, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Ca
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP, Flow-CS
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB

Publications for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807) (0)

There are no publications for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807) (0)

There are no reviews for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Fc epsilon RI beta/MS4A2 Products

Bioinformatics Tool for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807)

Discover related pathways, diseases and genes to Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807)

Discover more about diseases related to Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807).

Pathways for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807)

View related products by pathway.

PTMs for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807)

Learn more about PTMs related to Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807).

Research Areas for Fc epsilon RI beta/MS4A2 Antibody (NBP2-31807)

Find related products by research area.

Blogs on Fc epsilon RI beta/MS4A2

There are no specific blogs for Fc epsilon RI beta/MS4A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Fc epsilon RI beta/MS4A2 Antibody and receive a gift card or discount.


Gene Symbol MS4A2