Bcl G Antibody (6R9F3)

Western Blot: Bcl G Antibody (6R9F3) [NBP3-15746] - Western blot analysis of extracts of various cell lines, using BCL2L14/Bcl G antibody (NBP3-15746) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Western Blot: Bcl G Antibody (6R9F3) [NBP3-15746] - Western blot analysis of extracts of various cell lines, using BCL2L14/Bcl G antibody (NBP3-15746) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Immunohistochemistry: Bcl G Antibody (6R9F3) [NBP3-15746] - Immunohistochemistry analysis of Bcl G in paraffin-embedded human colon tissue using Bcl G Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Bcl G Antibody (6R9F3) [NBP3-15746] - Immunohistochemistry analysis of Bcl G in paraffin-embedded rat testis tissue using Bcl G Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Bcl G Antibody (6R9F3) [NBP3-15746] - Immunohistochemistry analysis of Bcl G in paraffin-embedded mouse testis tissue using Bcl G Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Bcl G Antibody (6R9F3) [NBP3-15746] - Immunohistochemistry analysis of Bcl G in paraffin-embedded Human lung adenocarcinoma tissue using Bcl G Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Bcl G Antibody (6R9F3) [NBP3-15746] - Immunohistochemistry analysis of Bcl G in paraffin-embedded mouse kidney tissue using Bcl G Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Bcl G Antibody (6R9F3) [NBP3-15746] - Immunohistochemistry analysis of Bcl G in paraffin-embedded rat kidney tissue using Bcl G Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 6R9F3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Bcl G Antibody (6R9F3) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Bcl G (Q9BZR8). MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTIT
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: BCL2L14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Bcl G Antibody (6R9F3)

• apoptosis facilitator Bcl-2-like protein 14
• Apoptosis regulator Bcl-G
• Bcl2-L-14
• BCL2-like 14 (apoptosis facilitator)
• BCL-G
• BCLGbcl2-L-14

Background

Members in the Bcl-2 family are critical regulators of apoptosis by either inhibiting or promoting cell death. Bcl-2 homology 3 (BH3) domain is a potent death domain. BH3 domain containing pro-apoptotic proteins, including Bad, Bax, Bid, Bik, and Hrk, form a growing subclass of the Bcl-2 family. A novel BH3 domain containing protein was recently identified and designated Bcl-G. The mRNA of Bcl-G encodes 2 isoforms, Bcl-GL, which is widely expressed in multiple tissues, and Bcl-GS, which is only found in testis. The Bcl-GS protein is predominantly localized to cytoplasmic organelles whereas Bcl-GL was distributed throughout the cytosol. Overexpression of either protein induced apoptosis, although Bcl-GS was far more potent than Bcl-GS. Apoptosis induction was dependent on the BH3 domain and could be suppressed by co-expression with the anti-apoptotic Bcl-XL protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCL2L14