HYPB Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HYPB Antibody [NBP1-89843] - Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles & cytosol.
Immunohistochemistry-Paraffin: HYPB Antibody [NBP1-89843] - Staining of human small intestine shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: HYPB Antibody [NBP1-89843] - Staining of human endometrium shows strong nuclear positivity in glandular and stromal cells.
Immunohistochemistry-Paraffin: HYPB Antibody [NBP1-89843] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: HYPB Antibody [NBP1-89843] - Staining of human cerebellum shows moderate nuclear positivity in Purkinje cells as well as in cells in molecular layer.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HYPB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAPPPVPVVPHVAAPVEVSSSQYVA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SETD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HYPB Protein (NBP1-89843PEP)
Publications
Read Publication using
NBP1-89843 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25728682).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HYPB Antibody

  • FLJ22472
  • FLJ23184
  • FLJ45883
  • FLJ46217
  • HIF1
  • HIF-1EC 2.1.1.43
  • HIP-1
  • histone-lysine N-methyltransferase SETD2
  • hSET2
  • huntingtin interacting protein 1
  • Huntingtin yeast partner B
  • Huntingtin-interacting protein 1
  • Huntingtin-interacting protein B
  • HYPBp231HBP
  • KIAA1732SET domain-containing protein 2
  • KMT3AHBP231
  • Lysine N-methyltransferase 3A
  • SET domain containing 2
  • SET2FLJ16420

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
NB100-485
Species: Hu
Applications: WB, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP2-32964
Species: Hu
Applications: Flow, ICC/IF, IHC-Fr
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-46403
Species: Hu
Applications: IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89843
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for HYPB Antibody (NBP1-89843)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HYPB Antibody (NBP1-89843) (0)

There are no reviews for HYPB Antibody (NBP1-89843). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HYPB Antibody (NBP1-89843) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HYPB Products

Bioinformatics Tool for HYPB Antibody (NBP1-89843)

Discover related pathways, diseases and genes to HYPB Antibody (NBP1-89843). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HYPB Antibody (NBP1-89843)

Discover more about diseases related to HYPB Antibody (NBP1-89843).
 

Pathways for HYPB Antibody (NBP1-89843)

View related products by pathway.

PTMs for HYPB Antibody (NBP1-89843)

Learn more about PTMs related to HYPB Antibody (NBP1-89843).

Blogs on HYPB

There are no specific blogs for HYPB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HYPB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SETD2