HUNK Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HUNK Antibody [NBP2-14110] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm & plasma membrane.
Immunohistochemistry-Paraffin: HUNK Antibody [NBP2-14110] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry: HUNK Antibody [NBP2-14110] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HUNK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSFPDKDSFGCRNIFRKTSDSNCVASSSMEFIPVPPPRTPRIVKKPEPHQ PGPGSTGIPHKEDPLMLDMVRSFESVDR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HUNK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HUNK Protein (NBP2-14110PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HUNK Antibody

  • B19
  • EC 2.7.11
  • EC 2.7.11.1
  • hormonally up-regulated neu tumor-associated kinase
  • hormonally upregulated neu tumor-associated kinase
  • hormonally up-regulated Neu-associated kinase
  • hormonally upregulated Neu-associated kinase
  • MAKV
  • serine/threonine protein kinase MAK-V
  • Serine/threonine-protein kinase MAK-V

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24567
Species: Hu
Applications: WB
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HUNK Antibody (NBP2-14110) (0)

There are no publications for HUNK Antibody (NBP2-14110).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HUNK Antibody (NBP2-14110) (0)

There are no reviews for HUNK Antibody (NBP2-14110). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HUNK Antibody (NBP2-14110) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HUNK Products

Bioinformatics Tool for HUNK Antibody (NBP2-14110)

Discover related pathways, diseases and genes to HUNK Antibody (NBP2-14110). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HUNK Antibody (NBP2-14110)

Discover more about diseases related to HUNK Antibody (NBP2-14110).
 

Pathways for HUNK Antibody (NBP2-14110)

View related products by pathway.

PTMs for HUNK Antibody (NBP2-14110)

Learn more about PTMs related to HUNK Antibody (NBP2-14110).
 

Research Areas for HUNK Antibody (NBP2-14110)

Find related products by research area.

Blogs on HUNK

There are no specific blogs for HUNK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HUNK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HUNK