HUNK Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HUNK Antibody [NBP2-14110] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm & plasma membrane.

Immunohistochemistry-Paraffin: HUNK Antibody [NBP2-14110] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HUNK Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: SSFPDKDSFGCRNIFRKTSDSNCVASSSMEFIPVPPPRTPRIVKKPEPHQPGPGSTGIPHKEDPLMLDMVRSFESVDR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HUNK
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HUNK Protein (NBP2-14110PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HUNK Antibody - BSA Free

• B19
• EC 2.7.11
• EC 2.7.11.1
• hormonally up-regulated neu tumor-associated kinase
• hormonally upregulated neu tumor-associated kinase
• hormonally up-regulated Neu-associated kinase
• hormonally upregulated Neu-associated kinase
• MAKV
• serine/threonine protein kinase MAK-V
• Serine/threonine-protein kinase MAK-V

Background

HUNK, an AMPK/SNF1-type protein kinase, contains a domain homologous to SNF1, a protein involved in the response to nutritional stress in yeast. HUNK has been shown to participate in vesicular transport. Additionally, functional studies in mice suggest that HUNK regulates endocytosis via interaction with rabaptin-5 protein and induces changes in mammary glands during pregnancy. HUNK expression has been documented in mouse brain, breast, embryo, and fetus. ESTs have been isolated from several human tissue libraries, including normal ear.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HUNK